From AureoWiki
Jump to navigation Jump to search

NCBI: 02-MAR-2017

Summary[edit | edit source]

  • organism: Staphylococcus aureus USA300_FPR3757
  • locus tag: SAUSA300_RS09425 [old locus tag: SAUSA300_1725 ]
  • pan locus tag?: SAUPAN004479000
  • symbol: SAUSA300_RS09425
  • pan gene symbol?: tal
  • synonym:
  • product: transaldolase

Genome View[edit | edit source]

Gene[edit | edit source]

General[edit | edit source]

  • type: CDS
  • locus tag: SAUSA300_RS09425 [old locus tag: SAUSA300_1725 ]
  • symbol: SAUSA300_RS09425
  • product: transaldolase
  • replicon: chromosome
  • strand: -
  • coordinates: 1907471..1908184
  • length: 714
  • essential: unknown

Accession numbers[edit | edit source]

  • Location: NC_007793 (1907471..1908184) NCBI
  • BioCyc:
  • MicrobesOnline:

Phenotype[edit | edit source]

Share your knowledge and add information here. [edit]

DNA sequence[edit | edit source]

  • 1
    61
    121
    181
    241
    301
    361
    421
    481
    541
    601
    661
    ATGGCTAAACTAAATATAGAAGTATTTGCGGACGGTGCAGATATTGAAGAAATGAAAGCA
    GCTTATAAAAACAAACAAGTGGATGGTTTTACAACAAATCCTAGTTTAATGGCTAAAGCG
    GGCGTAACAGATTACAAAGCTTTTGCTGAAGAAGCTGTGAAAGAAATTCCAGATGCTTCA
    ATTTCATTTGAAGTATTTGCAGACGATTTAGAAACTATGGAAAAAGAAGCAGCAATTTTA
    AAACAATATGGCGAAAATGTATTTGTTAAAATTCCTATTGTAAATACAAAAGGTGAATCA
    ACGATTCCTTTAATTAAAAAACTTTCAGCTGACAATGTGAGATTAAACGTTACGGCTGTT
    TACACAATTGAACAAGTTAAAGAAATAACTGAAGCAGTAACTGAAGGTGTGCCAACATAT
    GTTTCAGTATTTGCAGGACGTATTGCAGATACAGGCGTAGATCCATTACCATTAATGAAA
    GAGGCTGTAAAAGTTACGCATAGTAAAGACGGCGTTAAATTATTATGGGCAAGTTGCCGC
    GAATTATTCAATGTGATTCAAGCTGATGAAATTGGTGCAGATATTATTACATGCCCAGCA
    GATGTTGTGAAAAAAGTGAATACAAACTTAGGTCGCGATATTAACGAATTATCAGTAGAT
    ACAGTTAAAGGCTTTGCGAAAGATATTCAATCTTCAGGTCTTTCTATTCTATAA
    60
    120
    180
    240
    300
    360
    420
    480
    540
    600
    660
    714

Protein[edit | edit source]

General[edit | edit source]

  • locus tag: SAUSA300_RS09425 [old locus tag: SAUSA300_1725 ]
  • symbol: SAUSA300_RS09425
  • description: transaldolase
  • length: 237
  • theoretical pI: 4.45164
  • theoretical MW: 25719.3
  • GRAVY: 0.00632911

Function[edit | edit source]

  • reaction:
    EC 2.2.1.2?  ExPASy
    Transaldolase Sedoheptulose 7-phosphate + D-glyceraldehyde 3-phosphate = D-erythrose 4-phosphate + D-fructose 6-phosphate
  • TIGRFAM:
    Metabolism Energy metabolism Pentose phosphate pathway transaldolase (TIGR02134; EC 2.2.1.2; HMM-score: 442)
    and 3 more
    Metabolism Energy metabolism Pentose phosphate pathway fructose-6-phosphate aldolase (TIGR00875; EC 4.1.2.-; HMM-score: 102.1)
    Metabolism Energy metabolism Pentose phosphate pathway transaldolase (TIGR00874; EC 2.2.1.2; HMM-score: 24.1)
    Metabolism Energy metabolism Pentose phosphate pathway transaldolase (TIGR00876; EC 2.2.1.2; HMM-score: 22.1)
  • TheSEED:
  • PFAM:
    TIM_barrel (CL0036) TAL_FSA; Transaldolase/Fructose-6-phosphate aldolase (PF00923; HMM-score: 130)

Structure, modifications & interactions[edit | edit source]

Localization[edit | edit source]

  • PSORTb: unknown (no significant prediction)
    • Cytoplasmic Score: 2.5
    • Cytoplasmic Membrane Score: 2.5
    • Cellwall Score: 2.5
    • Extracellular Score: 2.5
    • Internal Helices: 0
  • LocateP:
  • SignalP: no predicted signal peptide
    • SP(Sec/SPI): 0.004279
    • TAT(Tat/SPI): 0.000541
    • LIPO(Sec/SPII): 0.000703
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit | edit source]

  • GI: 447019203 NCBI
  • RefSeq: WP_001096459 NCBI
  • UniProt:

Protein sequence[edit | edit source]

  • MAKLNIEVFADGADIEEMKAAYKNKQVDGFTTNPSLMAKAGVTDYKAFAEEAVKEIPDASISFEVFADDLETMEKEAAILKQYGENVFVKIPIVNTKGESTIPLIKKLSADNVRLNVTAVYTIEQVKEITEAVTEGVPTYVSVFAGRIADTGVDPLPLMKEAVKVTHSKDGVKLLWASCRELFNVIQADEIGADIITCPADVVKKVNTNLGRDINELSVDTVKGFAKDIQSSGLSIL

Experimental data[edit | edit source]

  • experimentally validated: no data available

Expression & Regulation[edit | edit source]

Operon[edit | edit source]

Regulation[edit | edit source]

  • regulator:

Transcription pattern[edit | edit source]

Protein synthesis (provided by Aureolib)[edit | edit source]

Protein stability[edit | edit source]

  • half-life: no data available

Biological Material[edit | edit source]

Mutants[edit | edit source]

Expression vector[edit | edit source]

lacZ fusion[edit | edit source]

GFP fusion[edit | edit source]

two-hybrid system[edit | edit source]

FLAG-tag construct[edit | edit source]

Antibody[edit | edit source]

Other Information[edit | edit source]

You are kindly invited to share additional interesting facts.

Literature[edit | edit source]

References[edit | edit source]

  1. 1.0 1.1 1.2 1.3 1.4 1.5 1.6 1.7 Artem Cherkasov, Michael Hsing, Roya Zoraghi, Leonard J Foster, Raymond H See, Nikolay Stoynov, Jihong Jiang, Sukhbir Kaur, Tian Lian, Linda Jackson, Huansheng Gong, Rick Swayze, Emily Amandoron, Farhad Hormozdiari, Phuong Dao, Cenk Sahinalp, Osvaldo Santos-Filho, Peter Axerio-Cilies, Kendall Byler, William R McMaster, Robert C Brunham, B Brett Finlay, Neil E Reiner
    Mapping the protein interaction network in methicillin-resistant Staphylococcus aureus.
    J Proteome Res: 2011, 10(3);1139-50
    [PubMed:21166474] [WorldCat.org] [DOI] (I p)

Relevant publications[edit | edit source]