Jump to navigation
Jump to search
COLN315NCTC8325NewmanUSA300_FPR3757JSNZ04-0298108BA0217611819-97685071193ECT-R 2ED133ED98HO 5096 0412JH1JH9JKD6008JKD6159LGA251M013MRSA252MSHR1132MSSA476MW2Mu3Mu50RF122ST398T0131TCH60TW20USA300_TCH1516VC40
NCBI: 02-MAR-2017
⊟Summary[edit | edit source]
- organism: Staphylococcus aureus USA300_FPR3757
- locus tag: SAUSA300_RS09545
- pan locus tag?:
- symbol: SAUSA300_RS09545
- pan gene symbol?: —
- synonym:
- product: hypothetical protein
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: SAUSA300_RS09545
- symbol: SAUSA300_RS09545
- product: hypothetical protein
- replicon: chromosome
- strand: -
- coordinates: 1927597..1927773
- length: 177
- essential: unknown
⊟Accession numbers[edit | edit source]
⊟Phenotype[edit | edit source]
Share your knowledge and add information here. [edit]
⊟DNA sequence[edit | edit source]
- 1
61
121ATGGATAGATTAAAATATTCACTTAAAGTTGGAATTTTAGCATTATTATTATTTTGTACT
TTAAATTATTTAGTTCCAATGCAAAGCAATGCTTTTTCAATAATTATATATTCGGCAATT
TTTGCTGTGTTACTTATGCTTTTAGTTTATATATTTTTAGGAATTTTAAAGAAATGA60
120
177
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: SAUSA300_RS09545
- symbol: SAUSA300_RS09545
- description: hypothetical protein
- length: 58
- theoretical pI: 9.92669
- theoretical MW: 6614.25
- GRAVY: 1.42241
⊟Function[edit | edit source]
- TIGRFAM: Cellular processes Toxin production and resistance bacteriocin-associated integral membrane protein (TIGR01654; HMM-score: 7.3)
- TheSEED:
- PFAM: no clan defined DUF3671; Fam-L, Fam-M like protein (PF12420; HMM-score: 9.3)Renin_r; Renin receptor-like transmembrane spanning segment (PF07850; HMM-score: 8.9)
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
⊟Localization[edit | edit source]
- PSORTb: Cytoplasmic Membrane
- Cytoplasmic Score: 0.32
- Cytoplasmic Membrane Score: 9.55
- Cellwall Score: 0.12
- Extracellular Score: 0.01
- Internal Helices: 2
- DeepLocPro: Cytoplasmic Membrane
- Cytoplasmic Score: 0
- Cytoplasmic Membrane Score: 0.9951
- Cell wall & surface Score: 0
- Extracellular Score: 0.0049
- LocateP:
- SignalP: no predicted signal peptide
- SP(Sec/SPI): 0.050714
- TAT(Tat/SPI): 0.00196
- LIPO(Sec/SPII): 0.339636
- predicted transmembrane helices (TMHMM): 2
⊟Accession numbers[edit | edit source]
⊟Protein sequence[edit | edit source]
- MDRLKYSLKVGILALLLFCTLNYLVPMQSNAFSIIIYSAIFAVLLMLLVYIFLGILKK
⊟Experimental data[edit | edit source]
- experimentally validated:
- protein localization:
- quantitative data / protein copy number per cell:
- interaction partners:
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
⊟Regulation[edit | edit source]
- regulator:
⊟Transcription pattern[edit | edit source]
- S.aureus Expression Data Browser: no data available
⊟Protein synthesis (provided by Aureolib)[edit | edit source]
- Aureolib: no data available
⊟Protein stability[edit | edit source]
- half-life: no data available
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Other Information[edit | edit source]
You can add further information about the gene and protein here. [edit]