From AureoWiki
Jump to navigation Jump to search

NCBI: 02-MAR-2017

Summary[edit | edit source]

  • organism: Staphylococcus aureus USA300_FPR3757
  • locus tag: SAUSA300_RS10305 [old locus tag: SAUSA300_1883 ]
  • pan locus tag?: SAUPAN004929000
  • symbol: SAUSA300_RS10305
  • pan gene symbol?: putP
  • synonym:
  • product: sodium:proline symporter

Genome View[edit | edit source]

Gene[edit | edit source]

General[edit | edit source]

  • type: CDS
  • locus tag: SAUSA300_RS10305 [old locus tag: SAUSA300_1883 ]
  • symbol: SAUSA300_RS10305
  • product: sodium:proline symporter
  • replicon: chromosome
  • strand: +
  • coordinates: 2044616..2046154
  • length: 1539
  • essential: unknown

Accession numbers[edit | edit source]

  • Location: NC_007793 (2044616..2046154) NCBI
  • BioCyc:
  • MicrobesOnline:

Phenotype[edit | edit source]

Share your knowledge and add information here. [edit]

DNA sequence[edit | edit source]

  • 1
    61
    121
    181
    241
    301
    361
    421
    481
    541
    601
    661
    721
    781
    841
    901
    961
    1021
    1081
    1141
    1201
    1261
    1321
    1381
    1441
    1501
    ATGCTTACAATGGGGACAGCATTAAGTCAACAAGTAGATGCCAATTGGCAAACTTATATT
    ATGATTGCCGTCTACTTCTTGATACTAATCGTTATTGGCTTTTACGGTTACAAGCAAGCA
    ACTGGTAACCTAAGCGAGTACATGTTAGGTGGACGTAGTATTGGACCGTATATTACTGCA
    TTATCAGCTGGAGCTTCAGATATGAGTGGATGGATGATTATGGGGCTACCTGGTTCTGTC
    TATAGCACTGGTCTATCAGCTATGTGGATTACAATCGGTTTAACATTAGGTGCTTATATA
    AATTACTTTGTTGTTGCTCCTAGACTTCGTGTTTATACCGAATTAGCTGGAGATGCAATT
    ACATTACCAGATTTCTTTAAAAATCGTTTAAACGATAAAAATAATGTGTTAAAGATTATT
    TCTGGATTGATTATCGTAGTATTCTTTACATTATATACACATTCTGGTTTCGTATCTGGT
    GGTAAACTATTTGAAAGTGCTTTTGGATTAGATTATCATTTCGGTTTAATATTAGTTGCT
    TTCATTGTCATTTTCTATACTTTCTTTGGTGGATATTTAGCTGTATCAATTACAGATTTC
    TTCCAAGGTGTCATTATGTTAATTGCGATGGTTATGGTCCCTATTGTTGCTATGATGAAT
    TTAAACGGCTGGGGAACGTTTCATGATGTAGCAGCTATGAAACCTACAAATTTAAATTTA
    TTTAAAGGGTTATCATTTATAGGAATTATCTCTCTATTTTCATGGGGATTAGGTTATTTC
    GGTCAACCTCATATCATTATAAGGTTTATGTCTATTAAATCACACAAGATGCTACCTAAA
    GCTAGACGTTTAGGTATTAGCTGGATGGCTGTTGGTTTATTAGGCGCTGTGGCTGTTGGT
    TTAACAGGTATTGCATTCGTACCTGCTTATCATATTAAACTAGAAGATCCTGAGACATTA
    TTCATCGTGATGAGTCAAGTACTCTTCCATCCTCTTGTAGGTGGTTTCTTACTTGCTGCG
    ATTCTAGCTGCAATTATGAGCACGATTTCTTCACAATTACTTGTAACATCTAGTTCACTA
    ACGGAAGACTTTTATAAATTAATTCGTGGTGAAGAAAAAGCTAAAACGCACCAAAAAGAA
    TTTGTTATGATTGGAAGATTATCTGTATTAGTTGTAGCAATTGTTGCCATCGCGATTGCA
    TGGAATCCAAACGACACAATTCTAAACTTAGTAGGTAACGCTTGGGCCGGATTTGGTGCA
    TCGTTCAGTCCACTTGTGCTATTTGCACTTTACTGGAAAGGTTTGACACGTGCCGGTGCT
    GTAAGTGGAATGGTTTCAGGTGCCTTAGTCGTTATCGTTTGGATTGCGTGGATTAAACCA
    TTGGCACATATCAACGAAATATTCGGCTTATATGAAATTATTCCTGGATTTATTGTAAGT
    GTAATCGTTACATATGTTGTAAGTAAACTTACTAAAAAACCTGGTGCATTTGTTGAAACT
    GACTTAAACAAAGTTCGTGACATCGTTAGAGAAAAATAA
    60
    120
    180
    240
    300
    360
    420
    480
    540
    600
    660
    720
    780
    840
    900
    960
    1020
    1080
    1140
    1200
    1260
    1320
    1380
    1440
    1500
    1539

Protein[edit | edit source]

General[edit | edit source]

  • locus tag: SAUSA300_RS10305 [old locus tag: SAUSA300_1883 ]
  • symbol: SAUSA300_RS10305
  • description: sodium:proline symporter
  • length: 512
  • theoretical pI: 9.68032
  • theoretical MW: 55989.2
  • GRAVY: 0.779297

Function[edit | edit source]

  • TIGRFAM:
    Metabolism Transport and binding proteins Amino acids, peptides and amines sodium/proline symporter (TIGR02121; HMM-score: 767.6)
    and 5 more
    Metabolism Transport and binding proteins Cations and iron carrying compounds transporter, solute:sodium symporter (SSS) family (TIGR00813; HMM-score: 296.9)
    Metabolism Biosynthesis of cofactors, prosthetic groups, and carriers Pantothenate and coenzyme A sodium/pantothenate symporter (TIGR02119; HMM-score: 202.3)
    Metabolism Transport and binding proteins Other sodium/pantothenate symporter (TIGR02119; HMM-score: 202.3)
    probable sodium:solute symporter, VC_2705 subfamily (TIGR03648; HMM-score: 121)
    Metabolism Transport and binding proteins Carbohydrates, organic alcohols, and acids cation/acetate symporter ActP (TIGR02711; HMM-score: 107.2)
  • TheSEED:
  • PFAM:
    APC (CL0062) SSF; Sodium:solute symporter family (PF00474; HMM-score: 328.7)

Structure, modifications & interactions[edit | edit source]

  • domains:
  • modifications:
  • cofactors:
  • effectors:
  • protein partners:

Localization[edit | edit source]

  • PSORTb: Cytoplasmic Membrane
    • Cytoplasmic Score: 0
    • Cytoplasmic Membrane Score: 10
    • Cellwall Score: 0
    • Extracellular Score: 0
    • Internal Helices: 13
  • LocateP:
  • SignalP: no predicted signal peptide
    • SP(Sec/SPI): 0.014411
    • TAT(Tat/SPI): 0.00039
    • LIPO(Sec/SPII): 0.001527
  • predicted transmembrane helices (TMHMM): 13

Accession numbers[edit | edit source]

  • GI: 446879759 NCBI
  • RefSeq: WP_000957015 NCBI
  • UniProt:

Protein sequence[edit | edit source]

  • MLTMGTALSQQVDANWQTYIMIAVYFLILIVIGFYGYKQATGNLSEYMLGGRSIGPYITALSAGASDMSGWMIMGLPGSVYSTGLSAMWITIGLTLGAYINYFVVAPRLRVYTELAGDAITLPDFFKNRLNDKNNVLKIISGLIIVVFFTLYTHSGFVSGGKLFESAFGLDYHFGLILVAFIVIFYTFFGGYLAVSITDFFQGVIMLIAMVMVPIVAMMNLNGWGTFHDVAAMKPTNLNLFKGLSFIGIISLFSWGLGYFGQPHIIIRFMSIKSHKMLPKARRLGISWMAVGLLGAVAVGLTGIAFVPAYHIKLEDPETLFIVMSQVLFHPLVGGFLLAAILAAIMSTISSQLLVTSSSLTEDFYKLIRGEEKAKTHQKEFVMIGRLSVLVVAIVAIAIAWNPNDTILNLVGNAWAGFGASFSPLVLFALYWKGLTRAGAVSGMVSGALVVIVWIAWIKPLAHINEIFGLYEIIPGFIVSVIVTYVVSKLTKKPGAFVETDLNKVRDIVREK

Experimental data[edit | edit source]

  • experimentally validated: no data available

Expression & Regulation[edit | edit source]

Operon[edit | edit source]

Regulation[edit | edit source]

  • regulator:

Transcription pattern[edit | edit source]

Protein synthesis (provided by Aureolib)[edit | edit source]

Protein stability[edit | edit source]

  • half-life: no data available

Biological Material[edit | edit source]

Mutants[edit | edit source]

Expression vector[edit | edit source]

lacZ fusion[edit | edit source]

GFP fusion[edit | edit source]

two-hybrid system[edit | edit source]

FLAG-tag construct[edit | edit source]

Antibody[edit | edit source]

Other Information[edit | edit source]

You are kindly invited to share additional interesting facts.

Literature[edit | edit source]

References[edit | edit source]

Relevant publications[edit | edit source]