From AureoWiki
Jump to navigation Jump to search
COLN315NCTC8325NewmanUSA300_FPR3757JSNZ04-0298108BA0217611819-97685071193ECT-R 2ED133ED98HO 5096 0412JH1JH9JKD6008JKD6159LGA251M013MRSA252MSHR1132MSSA476MW2Mu3Mu50RF122ST398T0131TCH60TW20USA300_TCH1516VC40

NCBI: 02-MAR-2017

Summary[edit | edit source]

  • organism: Staphylococcus aureus USA300_FPR3757
  • locus tag: SAUSA300_RS10795
  • pan locus tag?:
  • symbol: SAUSA300_RS10795
  • pan gene symbol?:
  • synonym:
  • product: hypothetical protein

Genome View[edit | edit source]

Gene[edit | edit source]

General[edit | edit source]

  • type: CDS
  • locus tag: SAUSA300_RS10795
  • symbol: SAUSA300_RS10795
  • product: hypothetical protein
  • replicon: chromosome
  • strand: -
  • coordinates: 2122608..2122823
  • length: 216
  • essential: unknown

Accession numbers[edit | edit source]

  • Location: NC_007793 (2122608..2122823) NCBI
  • BioCyc: SAUSA300_RS10795 BioCyc
  • MicrobesOnline:

Phenotype[edit | edit source]

Share your knowledge and add information here. [edit]

DNA sequence[edit | edit source]

  • 1
    61
    121
    181
    ATGAACATTCAAGAAGCAACGAAGCTAGCGATGGAGAAAGGAATAAGTATAAGGAGAGAG
    AATCAAGATGTGTATGGGATATTACCAACTAATTTGCAGCGTTATCAATGCCTAGTCGTA
    TCTAGACACTATAAGAAAAAAAGACAAACCGCCGCCGGAAGGTGGCAGCCTAGCGCAGAC
    GATTTAATAGCAGATGATTGGATTTTAGATTATTAA
    60
    120
    180
    216

Protein[edit | edit source]

General[edit | edit source]

  • locus tag: SAUSA300_RS10795
  • symbol: SAUSA300_RS10795
  • description: hypothetical protein
  • length: 71
  • theoretical pI: 9.0886
  • theoretical MW: 8324.45
  • GRAVY: -0.691549

Function[edit | edit source]

  • TIGRFAM:
  • TheSEED:
  • PFAM:
    no clan defined Tad2-like; Thoeris anti-defense 2-like domain (PF11195; HMM-score: 34.4)
    and 1 more
    VirB7; Outer membrane lipoprotein virB7 (PF17413; HMM-score: 13.9)

Structure, modifications & cofactors[edit | edit source]

  • domains:
  • modifications:
  • cofactors:
  • effectors:

Localization[edit | edit source]

  • PSORTb: unknown (no significant prediction)
    • Cytoplasmic Score: 2.5
    • Cytoplasmic Membrane Score: 2.5
    • Cellwall Score: 2.5
    • Extracellular Score: 2.5
    • Internal Helices: 0
  • DeepLocPro: Cytoplasmic
    • Cytoplasmic Score: 0.9293
    • Cytoplasmic Membrane Score: 0.0237
    • Cell wall & surface Score: 0.0015
    • Extracellular Score: 0.0454
  • LocateP:
  • SignalP: no predicted signal peptide
    • SP(Sec/SPI): 0.003849
    • TAT(Tat/SPI): 0.000868
    • LIPO(Sec/SPII): 0.001258
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit | edit source]

  • GI: 446948148 NCBI
  • RefSeq: WP_001025404 NCBI
  • UniProt:

Protein sequence[edit | edit source]

  • MNIQEATKLAMEKGISIRRENQDVYGILPTNLQRYQCLVVSRHYKKKRQTAAGRWQPSADDLIADDWILDY

Experimental data[edit | edit source]

  • experimentally validated:
  • protein localization:
  • quantitative data / protein copy number per cell:
  • interaction partners:

Expression & Regulation[edit | edit source]

Operon[edit | edit source]

Regulation[edit | edit source]

  • regulator:

Transcription pattern[edit | edit source]

Protein synthesis (provided by Aureolib)[edit | edit source]

Protein stability[edit | edit source]

  • half-life: no data available

Biological Material[edit | edit source]

Mutants[edit | edit source]

Expression vector[edit | edit source]

lacZ fusion[edit | edit source]

GFP fusion[edit | edit source]

two-hybrid system[edit | edit source]

FLAG-tag construct[edit | edit source]

Antibody[edit | edit source]

Other Information[edit | edit source]

You can add further information about the gene and protein here. [edit]

Literature[edit | edit source]

References[edit | edit source]

Relevant publications[edit | edit source]