From AureoWiki
Jump to navigation Jump to search

NCBI: 02-MAR-2017

⊟Summary[edit | edit source]

  • organism: Staphylococcus aureus USA300_FPR3757
  • locus tag: SAUSA300_RS11320 [old locus tag: SAUSA300_2056 ]
  • pan locus tag?: SAUPAN005389000
  • symbol: SAUSA300_RS11320
  • pan gene symbol?: —
  • synonym:
  • product: membrane protein

⊟Additional information (user-provided)[edit | edit source]

⊟Genome View[edit | edit source]

⊟Gene[edit | edit source]

⊟General[edit | edit source]

  • type: CDS
  • locus tag: SAUSA300_RS11320 [old locus tag: SAUSA300_2056 ]
  • symbol: SAUSA300_RS11320
  • product: membrane protein
  • replicon: chromosome
  • strand: -
  • coordinates: 2219722..2219955
  • length: 234
  • essential: unknown other strains

⊟Accession numbers[edit | edit source]

⊟Phenotype[edit | edit source]

⊟Additional information (user-provided)[edit | edit source]

⊟DNA sequence[edit | edit source]

  • 1
    61
    121
    181
    ATGGATTATATCGGACAATATGCAGTTATCCATTTAGTGTTACATGTTGTATGTATTTGT
    ATTGCCTATTGGGCTTTACAATCAATTAGATTAGATCAATTTTTTAAAAAAGGATACGCC
    ACTCAATTACAAGTGTGTATGATATTTGTTGCTATTTTATTAGGCACTGCAGTAAGCAAT
    TTTATTGTAGATTTGTTACAATACTCGACGCAGGTAAAATATTTAATAAAATAA
    60
    120
    180
    234


⊟Protein[edit | edit source]

⊟General[edit | edit source]

  • locus tag: SAUSA300_RS11320 [old locus tag: SAUSA300_2056 ]
  • symbol: SAUSA300_RS11320
  • description: membrane protein
  • length: 77
  • theoretical pI: 8.46673
  • theoretical MW: 8847.59
  • GRAVY: 0.911688

⊟Function[edit | edit source]

  • TIGRFAM:
    conserved hypothetical integral membrane protein (TIGR02327; HMM-score: 61.1)
  • TheSEED: see SAUSA300_2056
  • PFAM:
    no clan defined DUF1146; Protein of unknown function (DUF1146) (PF06612; HMM-score: 72.3)

⊟Structure, modifications & cofactors[edit | edit source]

  • domains:
  • modifications:
  • cofactors:
  • effectors:

⊟Localization[edit | edit source]

  • PSORTb: Cytoplasmic Membrane
    • Cytoplasmic Score: 0.32
    • Cytoplasmic Membrane Score: 9.55
    • Cellwall Score: 0.12
    • Extracellular Score: 0.01
    • Internal Helices: 2
  • DeepLocPro: Cytoplasmic Membrane
    • Cytoplasmic Score: 0
    • Cytoplasmic Membrane Score: 0.9991
    • Cell wall & surface Score: 0
    • Extracellular Score: 0.0008
  • LocateP:
  • SignalP: no predicted signal peptide
    • SP(Sec/SPI): 0.003159
    • TAT(Tat/SPI): 0.000129
    • LIPO(Sec/SPII): 0.03256
  • predicted transmembrane helices (TMHMM): 2

⊟Accession numbers[edit | edit source]

⊟Additional information (user-provided)[edit | edit source]

⊟Protein sequence[edit | edit source]

  • MDYIGQYAVIHLVLHVVCICIAYWALQSIRLDQFFKKGYATQLQVCMIFVAILLGTAVSNFIVDLLQYSTQVKYLIK

⊟Experimental data[edit | edit source]

  • experimentally validated:
  • protein localization:
  • quantitative data / protein copy number per cell:
  • interaction partners:

⊟Expression & Regulation[edit | edit source]

⊟Operon[edit | edit source]

⊟Regulation[edit | edit source]

⊟Additional information (user-provided)[edit | edit source]

⊟Transcription pattern[edit | edit source]

⊟Protein synthesis (provided by Aureolib)[edit | edit source]

⊟Protein stability[edit | edit source]

  • half-life: no data available

⊟Biological Material[edit | edit source]

⊟Mutants[edit | edit source]

⊟Expression vector[edit | edit source]

⊟lacZ fusion[edit | edit source]

⊟GFP fusion[edit | edit source]

⊟two-hybrid system[edit | edit source]

⊟FLAG-tag construct[edit | edit source]

⊟Antibody[edit | edit source]

⊟Additional information (user-provided)[edit | edit source]

⊟Other information (user-provided)[edit | edit source]

You can add further information about the gene and protein here. [edit]

⊟Literature[edit | edit source]

⊟References[edit | edit source]


⊟Relevant publications[edit | edit source]