Jump to navigation
Jump to search
NCBI: 02-MAR-2017
⊟Summary[edit | edit source]
- organism: Staphylococcus aureus USA300_FPR3757
- locus tag: SAUSA300_RS13765 [old locus tag: SAUSA300_2481 ]
- pan locus tag?: SAUPAN006200000
- symbol: SAUSA300_RS13765
- pan gene symbol?: —
- synonym:
- product: hypothetical protein
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: SAUSA300_RS13765 [old locus tag: SAUSA300_2481 ]
- symbol: SAUSA300_RS13765
- product: hypothetical protein
- replicon: chromosome
- strand: +
- coordinates: 2678764..2678982
- length: 219
- essential: unknown other strains
⊟Accession numbers[edit | edit source]
- Location: NC_007793 (2678764..2678982) NCBI
- BioCyc: SAUSA300_RS13765 BioCyc
- MicrobesOnline: see SAUSA300_2481
⊟Phenotype[edit | edit source]
Share your knowledge and add information here. [edit]
⊟DNA sequence[edit | edit source]
- 1
61
121
181TTGAGCTTTTACGAATTTATGCAAAGTTTTCTTGGTGATGACACACCATTAGGTGAATTG
GTTGATTGGATTAATCAAGATAGCAATTTCCCTAGAGAAGTGAAGAGCCATAGTGAAATA
TTGTCATATTTTCGAACAAATCCATGTCCTGAAAGCATCTCAGTACCTGTAATTAAACGG
GCACTATCAGTTTTCAACCAATTCACAAATGTACAATGA60
120
180
219
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: SAUSA300_RS13765 [old locus tag: SAUSA300_2481 ]
- symbol: SAUSA300_RS13765
- description: hypothetical protein
- length: 72
- theoretical pI: 4.34809
- theoretical MW: 8348.33
- GRAVY: -0.266667
⊟Function[edit | edit source]
- TIGRFAM:
- TheSEED: see SAUSA300_2481
- PFAM: no clan defined YozE_SAM_like; YozE SAM-like fold (PF06855; HMM-score: 67.5)and 1 moreDUF1885; Domain of unknown function (DUF1885) (PF08968; HMM-score: 12)
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
⊟Localization[edit | edit source]
- PSORTb: unknown (no significant prediction)
- Cytoplasmic Score: 2.5
- Cytoplasmic Membrane Score: 2.5
- Cellwall Score: 2.5
- Extracellular Score: 2.5
- Internal Helices: 0
- DeepLocPro: Cytoplasmic
- Cytoplasmic Score: 0.4554
- Cytoplasmic Membrane Score: 0.4125
- Cell wall & surface Score: 0.0001
- Extracellular Score: 0.1321
- LocateP:
- SignalP: no predicted signal peptide
- SP(Sec/SPI): 0.005104
- TAT(Tat/SPI): 0.000649
- LIPO(Sec/SPII): 0.000932
- predicted transmembrane helices (TMHMM): 0
⊟Accession numbers[edit | edit source]
- GI: 445933832 NCBI
- RefSeq: WP_000011687 NCBI
- UniProt: see SAUSA300_2481
⊟Protein sequence[edit | edit source]
- MSFYEFMQSFLGDDTPLGELVDWINQDSNFPREVKSHSEILSYFRTNPCPESISVPVIKRALSVFNQFTNVQ
⊟Experimental data[edit | edit source]
- experimentally validated:
- protein localization:
- quantitative data / protein copy number per cell:
- interaction partners:
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
⊟Regulation[edit | edit source]
- regulator:
⊟Transcription pattern[edit | edit source]
- S.aureus Expression Data Browser: data available for NCTC8325
⊟Protein synthesis (provided by Aureolib)[edit | edit source]
- Aureolib: no data available
⊟Protein stability[edit | edit source]
- half-life: no data available
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Other Information[edit | edit source]
You can add further information about the gene and protein here. [edit]