From AureoWiki
Jump to navigation Jump to search
04-0298108BA0217611819-97685071193COLECT-R 2ED133ED98HO 5096 0412JH1JH9JKD6008JKD6159LGA251M013MRSA252MSHR1132MSSA476MW2Mu3Mu50N315NCTC8325NewmanRF122ST398T0131TCH60TW20USA300_FPR3757USA300_TCH1516VC40

NCBI: 02-MAR-2017

Summary[edit | edit source]

  • organism: Staphylococcus aureus USA300_FPR3757
  • locus tag: SAUSA300_RS13835
  • pan locus tag?:
  • symbol: SAUSA300_RS13835
  • pan gene symbol?:
  • synonym:
  • product: hypothetical protein

Genome View[edit | edit source]

Gene[edit | edit source]

General[edit | edit source]

  • type: CDS
  • locus tag: SAUSA300_RS13835
  • symbol: SAUSA300_RS13835
  • product: hypothetical protein
  • replicon: chromosome
  • strand: -
  • coordinates: 2693260..2693427
  • length: 168
  • essential: unknown

Accession numbers[edit | edit source]

  • Location: NC_007793 (2693260..2693427) NCBI
  • BioCyc:
  • MicrobesOnline:

Phenotype[edit | edit source]

Share your knowledge and add information here. [edit]

DNA sequence[edit | edit source]

  • 1
    61
    121
    GTGAGATACGTTATTTCAATAATAATGGGAATTGTATTAGCAATTTGGTCATTTAAACAA
    CTGAGTCAAAGTCATTTAGATAGCGGATTTATTTTTTTCTTCATAGTTTATGTGTTGTGT
    ATCAGTTGTTTTAATAGCGATAAGCACGATAAAAATAAAAAACGATAG
    60
    120
    168

Protein[edit | edit source]

General[edit | edit source]

  • locus tag: SAUSA300_RS13835
  • symbol: SAUSA300_RS13835
  • description: hypothetical protein
  • length: 55
  • theoretical pI: 9.81263
  • theoretical MW: 6488.7
  • GRAVY: 0.474545

Function[edit | edit source]

  • TIGRFAM:
    exosortase F-associated protein (TIGR04127; HMM-score: 15.6)
  • TheSEED:
  • PFAM:
    no clan defined DUF3792; Protein of unknown function (DUF3792) (PF12670; HMM-score: 17.1)
    DUF2304; Uncharacterized conserved protein (DUF2304) (PF10066; HMM-score: 15.1)
    PqiA; Paraquat-inducible protein A (PF04403; HMM-score: 14)
    and 2 more
    Rab5ip; Rab5-interacting protein (Rab5ip) (PF07019; HMM-score: 13.5)
    LysE (CL0292) TauE; Sulfite exporter TauE/SafE (PF01925; HMM-score: 13.3)

Structure, modifications & interactions[edit | edit source]

  • domains:
  • modifications:
  • cofactors:
  • effectors:
  • protein partners:

Localization[edit | edit source]

  • PSORTb: Cytoplasmic Membrane
    • Cytoplasmic Score: 0.32
    • Cytoplasmic Membrane Score: 9.55
    • Cellwall Score: 0.12
    • Extracellular Score: 0.01
    • Internal Helices: 2
  • LocateP:
  • SignalP: no predicted signal peptide
    • SP(Sec/SPI): 0.19773
    • TAT(Tat/SPI): 0.001333
    • LIPO(Sec/SPII): 0.077303
  • predicted transmembrane helices (TMHMM): 2

Accession numbers[edit | edit source]

  • GI:
  • RefSeq: WP_001791768 NCBI
  • UniProt:

Protein sequence[edit | edit source]

  • MRYVISIIMGIVLAIWSFKQLSQSHLDSGFIFFFIVYVLCISCFNSDKHDKNKKR

Experimental data[edit | edit source]

  • experimentally validated: no data available

Expression & Regulation[edit | edit source]

Operon[edit | edit source]

Regulation[edit | edit source]

  • regulator:

Transcription pattern[edit | edit source]

Protein synthesis (provided by Aureolib)[edit | edit source]

Protein stability[edit | edit source]

  • half-life: no data available

Biological Material[edit | edit source]

Mutants[edit | edit source]

Expression vector[edit | edit source]

lacZ fusion[edit | edit source]

GFP fusion[edit | edit source]

two-hybrid system[edit | edit source]

FLAG-tag construct[edit | edit source]

Antibody[edit | edit source]

Other Information[edit | edit source]

You are kindly invited to share additional interesting facts.

Literature[edit | edit source]

References[edit | edit source]

Relevant publications[edit | edit source]