From AureoWiki
Jump to navigation Jump to search

NCBI: 02-MAR-2017

Summary[edit | edit source]

  • organism: Staphylococcus aureus USA300_FPR3757
  • locus tag: SAUSA300_RS13995 [old locus tag: SAUSA300_2522 ]
  • pan locus tag?: SAUPAN006264000
  • symbol: SAUSA300_RS13995
  • pan gene symbol?:
  • synonym:
  • product: type II secretion protein

Genome View[edit | edit source]

Gene[edit | edit source]

General[edit | edit source]

  • type: CDS
  • locus tag: SAUSA300_RS13995 [old locus tag: SAUSA300_2522 ]
  • symbol: SAUSA300_RS13995
  • product: type II secretion protein
  • replicon: chromosome
  • strand: -
  • coordinates: 2725482..2725778
  • length: 297
  • essential: unknown other strains

Accession numbers[edit | edit source]

Phenotype[edit | edit source]

Share your knowledge and add information here. [edit]

DNA sequence[edit | edit source]

  • 1
    61
    121
    181
    241
    ATGGAAACAATAGGAAGCATTATTTATTTAAAAGAAGGTTCGCAAAAGTTAATGATTATT
    AATAGAGGACCAATTGTAGAAATTGAAAATCAAAAGTATATGTTTGACTATTCTGCATGT
    AAATATCCGATTGGTGTTGTAGAAGATGAAATTTATTATTTTAACGAGGAAAATATAGAT
    TCAGTTATTTTTAAAGGTTATTCTGATCAAGATGAGGTTAGATTTCAAGAGTTGTTTGAA
    AATATGAAACAAAATTTGGATAGTGAAATACAACGTGGAGAAGTTACACAACAATAA
    60
    120
    180
    240
    297

Protein[edit | edit source]

General[edit | edit source]

  • locus tag: SAUSA300_RS13995 [old locus tag: SAUSA300_2522 ]
  • symbol: SAUSA300_RS13995
  • description: type II secretion protein
  • length: 98
  • theoretical pI: 4.01648
  • theoretical MW: 11577.9
  • GRAVY: -0.540816

Function[edit | edit source]

  • TIGRFAM:
    mobile rSAM pair MarR family regulator (TIGR04472; HMM-score: 14.3)
  • TheSEED: see SAUSA300_2522
  • PFAM:
    no clan defined DUF4176; Domain of unknown function (DUF4176) (PF13780; HMM-score: 91.8)
    and 3 more
    UBA (CL0214) HBS1_N; HBS1 N-terminus (PF08938; HMM-score: 17.8)
    no clan defined DUF6843; Family of unknown function (DUF6843) (PF20862; HMM-score: 15.3)
    ZnExoPePases (CL0865) DUF4910; Domain of unknown function (DUF4910) (PF16254; HMM-score: 11.4)

Structure, modifications & cofactors[edit | edit source]

  • domains:
  • modifications:
  • cofactors:
  • effectors:

Localization[edit | edit source]

  • PSORTb: Cytoplasmic
    • Cytoplasmic Score: 7.5
    • Cytoplasmic Membrane Score: 1.15
    • Cellwall Score: 0.62
    • Extracellular Score: 0.73
    • Internal Helices: 0
  • DeepLocPro: Cytoplasmic
    • Cytoplasmic Score: 0.9657
    • Cytoplasmic Membrane Score: 0.018
    • Cell wall & surface Score: 0.0002
    • Extracellular Score: 0.0161
  • LocateP:
  • SignalP: no predicted signal peptide
    • SP(Sec/SPI): 0.006296
    • TAT(Tat/SPI): 0.000112
    • LIPO(Sec/SPII): 0.001784
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit | edit source]

Protein sequence[edit | edit source]

  • METIGSIIYLKEGSQKLMIINRGPIVEIENQKYMFDYSACKYPIGVVEDEIYYFNEENIDSVIFKGYSDQDEVRFQELFENMKQNLDSEIQRGEVTQQ

Experimental data[edit | edit source]

  • experimentally validated: data available for COL, NCTC8325
  • protein localization: data available for COL
  • quantitative data / protein copy number per cell: data available for COL
  • interaction partners:

Expression & Regulation[edit | edit source]

Operon[edit | edit source]

Regulation[edit | edit source]

  • regulator:

Transcription pattern[edit | edit source]

Protein synthesis (provided by Aureolib)[edit | edit source]

Protein stability[edit | edit source]

  • half-life: no data available

Biological Material[edit | edit source]

Mutants[edit | edit source]

Expression vector[edit | edit source]

lacZ fusion[edit | edit source]

GFP fusion[edit | edit source]

two-hybrid system[edit | edit source]

FLAG-tag construct[edit | edit source]

Antibody[edit | edit source]

Other Information[edit | edit source]

You can add further information about the gene and protein here. [edit]

Literature[edit | edit source]

References[edit | edit source]

Relevant publications[edit | edit source]