From AureoWiki
Jump to navigation Jump to search

NCBI: 02-MAR-2017

Summary[edit | edit source]

  • organism: Staphylococcus aureus USA300_FPR3757
  • locus tag: SAUSA300_RS14010 [old locus tag: SAUSA300_2525 ]
  • pan locus tag?: SAUPAN006268000
  • symbol: SAUSA300_RS14010
  • pan gene symbol?:
  • synonym:
  • product: fructosamine kinase family protein

Genome View[edit | edit source]

Gene[edit | edit source]

General[edit | edit source]

  • type: CDS
  • locus tag: SAUSA300_RS14010 [old locus tag: SAUSA300_2525 ]
  • symbol: SAUSA300_RS14010
  • product: fructosamine kinase family protein
  • replicon: chromosome
  • strand: -
  • coordinates: 2726769..2727635
  • length: 867
  • essential: unknown

Accession numbers[edit | edit source]

  • Location: NC_007793 (2726769..2727635) NCBI
  • BioCyc:
  • MicrobesOnline:

Phenotype[edit | edit source]

Share your knowledge and add information here. [edit]

DNA sequence[edit | edit source]

  • 1
    61
    121
    181
    241
    301
    361
    421
    481
    541
    601
    661
    721
    781
    841
    ATGAATGAACAATGGTTAGAGCATTTACCTTTAAAAGATATTAAAGAGATTTCACCAGTG
    AGTGGTGGTGATGTAAACGAAGCATATCGAGTCGAAACAGATACGGATACATTTTTCTTA
    CTTGTCCAACGTGGACGTAAAGAATCATTTTATGCTGCAGAAATTGCAGGTTTAAATGAA
    TTTGAACGTGCAGGTATCACGGCACCTAGAGTAATTGCAAGTGGCGAGGTTAACGGTGAT
    GCGTATTTAGTGATGACGTATTTAGAAGAAGGGGCTTCAGGGAGTCAACGCCAATTAGGG
    CAACTCGTAGCTCAATTACACAGTCAGCAACAAGAAGAAGGCAAATTTGGCTTCTCATTA
    CCTTATGAAGGTGGCGATATTTCTTTTGATAATCATTGGCAAGACGATTGGTGTACCATT
    TTTGTCGACAAACGCTTGGACCATTTGAAAGATGAGTTGCTAAATAGAGGGCTATGGGAT
    GCCAACGATATCAAAGTATATGACAAAGTGCGACGTCAAATTGTGGCGGAATTAGAAAAG
    CATCAAAGTAAACCGTCTTTATTACATGGTGACCTATGGGGTGGTAATTATATGTTCTTA
    CAAGATGGTCGTCCGGCGTTATTTGATCCAGCGCCATTATATGGTGACAGAGAATTCGAT
    ATCGGTATTACAACGGTATTTGGTGGTTTTACGAGCGAATTTTATGATGCGTATAATAAA
    CATTATCCACTCGCAAAAGGTGCATCCTATAGACTTGAATTTTATCGTTTATATTTATTG
    ATGGTCCATTTATTGAAATTTGGTGAGATGTACCGTGATAGTGTTGCGCATTCTATGGAT
    AAGATTTTACAAGATACAACAAGTTAG
    60
    120
    180
    240
    300
    360
    420
    480
    540
    600
    660
    720
    780
    840
    867

Protein[edit | edit source]

General[edit | edit source]

  • locus tag: SAUSA300_RS14010 [old locus tag: SAUSA300_2525 ]
  • symbol: SAUSA300_RS14010
  • description: fructosamine kinase family protein
  • length: 288
  • theoretical pI: 4.67614
  • theoretical MW: 32987.7
  • GRAVY: -0.456944

Function[edit | edit source]

  • TIGRFAM:
    fibrobacter succinogenes paralogous family TIGR02172 (TIGR02172; HMM-score: 12.1)
    S-methyl-5-thioribose kinase (TIGR01767; EC 2.7.1.100; HMM-score: 11.6)
  • TheSEED:
  • PFAM:
    PKinase (CL0016) Fructosamin_kin; Fructosamine kinase (PF03881; HMM-score: 254.3)
    and 3 more
    APH; Phosphotransferase enzyme family (PF01636; HMM-score: 68.1)
    APH_6_hur; Aminoglycoside/hydroxyurea antibiotic resistance kinase (PF04655; HMM-score: 16.7)
    EcKinase; Ecdysteroid kinase (PF02958; HMM-score: 12.6)

Structure, modifications & interactions[edit | edit source]

  • domains:
  • modifications:
  • cofactors:
  • effectors:
  • protein partners:

Localization[edit | edit source]

  • PSORTb: Cytoplasmic
    • Cytoplasmic Score: 7.5
    • Cytoplasmic Membrane Score: 1.15
    • Cellwall Score: 0.62
    • Extracellular Score: 0.73
    • Internal Helices: 0
  • LocateP:
  • SignalP: no predicted signal peptide
    • SP(Sec/SPI): 0.003583
    • TAT(Tat/SPI): 0.000727
    • LIPO(Sec/SPII): 0.00053
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit | edit source]

  • GI: 446928255 NCBI
  • RefSeq: WP_001005511 NCBI
  • UniProt:

Protein sequence[edit | edit source]

  • MNEQWLEHLPLKDIKEISPVSGGDVNEAYRVETDTDTFFLLVQRGRKESFYAAEIAGLNEFERAGITAPRVIASGEVNGDAYLVMTYLEEGASGSQRQLGQLVAQLHSQQQEEGKFGFSLPYEGGDISFDNHWQDDWCTIFVDKRLDHLKDELLNRGLWDANDIKVYDKVRRQIVAELEKHQSKPSLLHGDLWGGNYMFLQDGRPALFDPAPLYGDREFDIGITTVFGGFTSEFYDAYNKHYPLAKGASYRLEFYRLYLLMVHLLKFGEMYRDSVAHSMDKILQDTTS

Experimental data[edit | edit source]

  • experimentally validated: no data available

Expression & Regulation[edit | edit source]

Operon[edit | edit source]

Regulation[edit | edit source]

  • regulator:

Transcription pattern[edit | edit source]

Protein synthesis (provided by Aureolib)[edit | edit source]

Protein stability[edit | edit source]

  • half-life: no data available

Biological Material[edit | edit source]

Mutants[edit | edit source]

Expression vector[edit | edit source]

lacZ fusion[edit | edit source]

GFP fusion[edit | edit source]

two-hybrid system[edit | edit source]

FLAG-tag construct[edit | edit source]

Antibody[edit | edit source]

Other Information[edit | edit source]

You are kindly invited to share additional interesting facts.

Literature[edit | edit source]

References[edit | edit source]

Relevant publications[edit | edit source]