From AureoWiki
Jump to navigation Jump to search
COLN315NCTC8325NewmanUSA300_FPR375704-0298108BA0217611819-97685071193ECT-R 2ED133ED98HO 5096 0412JH1JH9JKD6008JKD6159LGA251M013MRSA252MSHR1132MSSA476MW2Mu3Mu50RF122ST398T0131TCH60TW20USA300_TCH1516VC40

NCBI: 02-MAR-2017

Summary[edit | edit source]

  • organism: Staphylococcus aureus USA300_FPR3757
  • locus tag: SAUSA300_RS14990
  • pan locus tag?:
  • symbol: SAUSA300_RS14990
  • pan gene symbol?:
  • synonym:
  • product: NAD(P)/FAD-dependent oxidoreductase

Genome View[edit | edit source]

Gene[edit | edit source]

General[edit | edit source]

  • type: CDS
  • locus tag: SAUSA300_RS14990
  • symbol: SAUSA300_RS14990
  • product: NAD(P)/FAD-dependent oxidoreductase
  • replicon: chromosome
  • strand: +
  • coordinates: 95561..95815
  • length: 255
  • essential: unknown

Accession numbers[edit | edit source]

  • Location: NC_007793 (95561..95815) NCBI
  • BioCyc: SAUSA300_RS14990 BioCyc
  • MicrobesOnline:

Phenotype[edit | edit source]

Share your knowledge and add information here. [edit]

DNA sequence[edit | edit source]

  • 1
    61
    121
    181
    241
    ATGAATAAGCATTATCAAATTGTTATTATTGGTGGCGGTACAGCAGGTGTTACCGTAGCA
    TCAAGACTATTAAGAAAAAATCAAAACTTAAAAGAGAAAATAGCAATTATAGATCCAGCA
    GACCATCATTACTATCAACCATTATGGACGTTGGTTGGTGCAGGGGTATCTAGTTTGAAA
    AGTTCTCGTAAAGATATGGAAAGTGTTATACCTGAAGGTGCTAACTGGATAAAACAGGCT
    GTTTCAAGTTTTTAA
    60
    120
    180
    240
    255

Protein[edit | edit source]

General[edit | edit source]

  • locus tag: SAUSA300_RS14990
  • symbol: SAUSA300_RS14990
  • description: NAD(P)/FAD-dependent oxidoreductase
  • length: 84
  • theoretical pI: 10.1846
  • theoretical MW: 9234.58
  • GRAVY: -0.164286

Function[edit | edit source]

  • TIGRFAM:
    Metabolism Biosynthesis of cofactors, prosthetic groups, and carriers Menaquinone and ubiquinone ubiquinone biosynthesis hydroxylase, UbiH/UbiF/VisC/COQ6 family (TIGR01988; EC 1.14.13.-; HMM-score: 18.9)
    lycopene cyclase family protein (TIGR01790; HMM-score: 17.3)
    ubiquinone biosynthesis monooxygenase COQ6 (TIGR01989; EC 1.14.13.-; HMM-score: 16.9)
    Cellular processes Cellular processes Detoxification CoA-disulfide reductase (TIGR03385; EC 1.8.1.14; HMM-score: 16.5)
    Metabolism Biosynthesis of cofactors, prosthetic groups, and carriers Menaquinone and ubiquinone 2-polyprenyl-6-methoxyphenol 4-hydroxylase (TIGR01984; EC 1.14.13.-; HMM-score: 15.8)
    and 9 more
    Genetic information processing Protein synthesis tRNA and rRNA base modification tRNA U-34 5-methylaminomethyl-2-thiouridine biosynthesis protein MnmC, C-terminal domain (TIGR03197; HMM-score: 13.4)
    squalene-associated FAD-dependent desaturase (TIGR03467; HMM-score: 12.7)
    Metabolism Biosynthesis of cofactors, prosthetic groups, and carriers Chlorophyll and bacteriochlorphyll geranylgeranyl reductase family (TIGR02032; EC 1.3.1.-; HMM-score: 12.4)
    salicylate 1-monooxygenase (TIGR03219; EC 1.14.13.1; HMM-score: 12.2)
    Metabolism Amino acid biosynthesis Glutamate family pyrroline-5-carboxylate reductase (TIGR00112; EC 1.5.1.2; HMM-score: 12)
    Unknown function Enzymes of unknown specificity flavoprotein, HI0933 family (TIGR00275; HMM-score: 11.9)
    Metabolism Biosynthesis of cofactors, prosthetic groups, and carriers Thiamine glycine oxidase ThiO (TIGR02352; EC 1.4.3.19; HMM-score: 11.9)
    Metabolism Energy metabolism Anaerobic glycerol-3-phosphate dehydrogenase, anaerobic, B subunit (TIGR03378; EC 1.1.5.3; HMM-score: 11.1)
    flavin-dependent oxidoreductase, MSMEG_0569 family (TIGR04046; HMM-score: 11)
  • TheSEED:
  • PFAM:
    NADP_Rossmann (CL0063) Pyr_redox_2; Pyridine nucleotide-disulphide oxidoreductase (PF07992; HMM-score: 25.4)
    NAD_binding_9; FAD-NAD(P)-binding (PF13454; HMM-score: 24.7)
    Lycopene_cycl; Lycopene cyclase protein (PF05834; HMM-score: 21.3)
    and 9 more
    NAD_binding_8; NAD(P)-binding Rossmann-like domain (PF13450; HMM-score: 20)
    Sacchrp_dh_NADP; Saccharopine dehydrogenase NADP binding domain (PF03435; HMM-score: 19.7)
    DAO; FAD dependent oxidoreductase (PF01266; HMM-score: 19.5)
    Pyr_redox; Pyridine nucleotide-disulphide oxidoreductase (PF00070; HMM-score: 17.5)
    TrkA_N; TrkA-N domain (PF02254; HMM-score: 17.4)
    Trp_halogenase; Tryptophan halogenase (PF04820; HMM-score: 17.3)
    F420_oxidored; NADP oxidoreductase coenzyme F420-dependent (PF03807; HMM-score: 16.6)
    Thi4; Thi4 family (PF01946; HMM-score: 14)
    HI0933_like; HI0933-like protein (PF03486; HMM-score: 12.8)

Structure, modifications & cofactors[edit | edit source]

  • domains:
  • modifications:
  • cofactors:
  • effectors:

Localization[edit | edit source]

  • PSORTb: unknown (no significant prediction)
    • Cytoplasmic Score: 2.5
    • Cytoplasmic Membrane Score: 2.5
    • Cellwall Score: 2.5
    • Extracellular Score: 2.5
    • Internal Helix: 1
  • LocateP:
  • SignalP: no predicted signal peptide
    • SP(Sec/SPI): 0.021445
    • TAT(Tat/SPI): 0.002427
    • LIPO(Sec/SPII): 0.015703
  • predicted transmembrane helices (TMHMM): 1

Accession numbers[edit | edit source]

  • GI:
  • RefSeq: WP_001033014 NCBI
  • UniProt:

Protein sequence[edit | edit source]

  • MNKHYQIVIIGGGTAGVTVASRLLRKNQNLKEKIAIIDPADHHYYQPLWTLVGAGVSSLKSSRKDMESVIPEGANWIKQAVSSF

Experimental data[edit | edit source]

  • experimentally validated:
  • protein localization:
  • quantitative data / protein copy number per cell:
  • interaction partners:

Expression & Regulation[edit | edit source]

Operon[edit | edit source]

Regulation[edit | edit source]

  • regulator:

Transcription pattern[edit | edit source]

Protein synthesis (provided by Aureolib)[edit | edit source]

Protein stability[edit | edit source]

  • half-life: no data available

Biological Material[edit | edit source]

Mutants[edit | edit source]

Expression vector[edit | edit source]

lacZ fusion[edit | edit source]

GFP fusion[edit | edit source]

two-hybrid system[edit | edit source]

FLAG-tag construct[edit | edit source]

Antibody[edit | edit source]

Other Information[edit | edit source]

You are kindly invited to share additional interesting facts.

Literature[edit | edit source]

References[edit | edit source]

Relevant publications[edit | edit source]