From AureoWiki
Jump to: navigation, search
04-0298108BA0217611819-97685071193COLECT-R 2ED133ED98HO 5096 0412JH1JH9JKD6008JKD6159LGA251M013MRSA252MSHR1132MSSA476MW2Mu3Mu50N315NCTC8325NewmanRF122ST398T0131TCH60TW20USA300_FPR3757USA300_TCH1516VC40

NCBI: 02-MAR-2017

Summary[edit source | edit]

  • organism: Staphylococcus aureus USA300_FPR3757
  • locus tag: SAUSA300_RS14995
  • pan locus tag?:
  • symbol: SAUSA300_RS14995
  • pan gene symbol?:
  • synonym:
  • product: NAD(P)/FAD-dependent oxidoreductase

Genome View[edit source | edit]

Gene[edit source | edit]

General[edit source | edit]

  • type: CDS
  • locus tag: SAUSA300_RS14995
  • symbol: SAUSA300_RS14995
  • product: NAD(P)/FAD-dependent oxidoreductase
  • replicon: chromosome
  • strand: +
  • coordinates: 96065..96754
  • length: 690
  • essential: unknown

Accession numbers[edit source | edit]

  • Location: NC_007793 (96065..96754) NCBI
  • BioCyc:
  • MicrobesOnline:

Phenotype[edit source | edit]

Share your knowledge and add information here. [edit]

DNA sequence[edit source | edit]

  • 1
    61
    121
    181
    241
    301
    361
    421
    481
    541
    601
    661
    ATGAAAATTATGTATTTAGCTGAAGATTATTTTAGGAAACATAAAATCCGTTCTAACGCT
    AATGTGATATATGCAACGCCAAAAGATGCTTTATTTGACGTAGGAAAATATAATAAAGAA
    TTAGAAAGGATTGTTGAAGAAAGAAATATAACAGTCAATTATAATTATAACCTTGTTGAA
    ATCGACGGTGACAAAAAAGTGGCTACATTCGAACATATCAAAGCATACGATAGAAAAACA
    ATAAGTTATGATATGTTACATGTAACACCACCTATGGGTCCCTTAGATGTAGTAAAAGAA
    AGTACACTTTCAGATAGTGAGGGTTGGGTAGATGTTAACCCAACCACATTACAGCATAAA
    AGCTACTCTAATGTATTTGCACTTGGTGATGCTTCAAATGTACCTACTTCAAAAACAGGC
    GCAGCTATTCGTAAGCAAGCACCTATCGTCGCTAATAATTTATTGCAAGTGATGAATAAT
    CAAATGTTAACGCATCATTATGATGGTTATACTTCATGCCCTATTGTTACTGGATATAAT
    AGGTTAATACTTGCAGAGTTTGATTATAATAAAAATACTAAAGAAACAATGCCGTTTAAT
    CAGGCCAAAGAACGTAGAAGTATGTATATATTTAAGAAAGATTTATTACCTAAAATGTAT
    TGGTACGGCATGCTAAAAGGATTAATATAA
    60
    120
    180
    240
    300
    360
    420
    480
    540
    600
    660
    690

Protein[edit source | edit]

General[edit source | edit]

  • locus tag: SAUSA300_RS14995
  • symbol: SAUSA300_RS14995
  • description: NAD(P)/FAD-dependent oxidoreductase
  • length: 229
  • theoretical pI: 9.21268
  • theoretical MW: 26440.2
  • GRAVY: -0.480786

Function[edit source | edit]

  • TIGRFAM:
    pyridine nucleotide-disulfide oxidoreductase family protein (TIGR03169; HMM-score: 37.7)
    and 3 more
    MetabolismEnergy metabolismElectron transportthioredoxin-disulfide reductase (TIGR01292; EC 1.8.1.9; HMM-score: 19)
    Cellular processesCellular processesDetoxificationCoA-disulfide reductase (TIGR03385; EC 1.8.1.14; HMM-score: 17.9)
    oxidoreductase/SelD-related fusion protein (TIGR04369; HMM-score: 12.3)
  • TheSEED:
  • PFAM:
    NADP_Rossmann (CL0063) Pyr_redox_2; Pyridine nucleotide-disulphide oxidoreductase (PF07992; HMM-score: 23.4)
    and 1 more
    Pyr_redox; Pyridine nucleotide-disulphide oxidoreductase (PF00070; HMM-score: 12.9)

Structure, modifications & interactions[edit source | edit]

  • domains:
  • modifications:
  • cofactors:
  • effectors:
  • protein partners:

Localization[edit source | edit]

  • PSORTb: unknown (no significant prediction)
    • Cytoplasmic Score: 2.5
    • Cytoplasmic Membrane Score: 2.5
    • Cellwall Score: 2.5
    • Extracellular Score: 2.5
    • Internal Helices: 0
  • LocateP:
  • SignalP: no predicted signal peptide
    • SP(Sec/SPI): 0.006398
    • TAT(Tat/SPI): 0.00027
    • LIPO(Sec/SPII): 0.001724
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit source | edit]

  • GI:
  • RefSeq: WP_000700037 NCBI
  • UniProt:

Protein sequence[edit source | edit]

  • MKIMYLAEDYFRKHKIRSNANVIYATPKDALFDVGKYNKELERIVEERNITVNYNYNLVEIDGDKKVATFEHIKAYDRKTISYDMLHVTPPMGPLDVVKESTLSDSEGWVDVNPTTLQHKSYSNVFALGDASNVPTSKTGAAIRKQAPIVANNLLQVMNNQMLTHHYDGYTSCPIVTGYNRLILAEFDYNKNTKETMPFNQAKERRSMYIFKKDLLPKMYWYGMLKGLI

Experimental data[edit source | edit]

  • experimentally validated: no data available

Expression & Regulation[edit source | edit]

Operon[edit source | edit]

Regulation[edit source | edit]

  • regulator:

Transcription pattern[edit source | edit]

Protein synthesis (provided by Aureolib)[edit source | edit]

Protein stability[edit source | edit]

  • half-life: no data available

Biological Material[edit source | edit]

Mutants[edit source | edit]

Expression vector[edit source | edit]

lacZ fusion[edit source | edit]

GFP fusion[edit source | edit]

two-hybrid system[edit source | edit]

FLAG-tag construct[edit source | edit]

Antibody[edit source | edit]

Other Information[edit source | edit]

You are kindly invited to share additional interesting facts.

Literature[edit source | edit]

References[edit source | edit]

Relevant publications[edit source | edit]