Jump to navigation
Jump to search
COLN315NCTC8325NewmanUSA300_FPR375704-0298108BA0217611819-97685071193ECT-R 2ED133ED98HO 5096 0412JH1JH9JKD6008JKD6159LGA251M013MRSA252MSHR1132MSSA476MW2Mu3Mu50RF122ST398T0131TCH60TW20USA300_TCH1516VC40
NCBI: 02-MAR-2017
⊟Summary[edit | edit source]
- organism: Staphylococcus aureus USA300_FPR3757
- locus tag: SAUSA300_RS15115
- pan locus tag?:
- symbol: SAUSA300_RS15115
- pan gene symbol?: —
- synonym:
- product: 50S ribosomal protein L33
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: SAUSA300_RS15115
- symbol: SAUSA300_RS15115
- product: 50S ribosomal protein L33
- replicon: chromosome
- strand: +
- coordinates: 580928..581071
- length: 144
- essential: unknown
⊟Accession numbers[edit | edit source]
- Location: NC_007793 (580928..581071) NCBI
- BioCyc:
- MicrobesOnline:
⊟Phenotype[edit | edit source]
Share your knowledge and add information here. [edit]
⊟DNA sequence[edit | edit source]
- 1
61
121GTGAGAAAAATACCTTTAAATTGTGAAGCTTGTGGCAATAGAAATTATAATGTTCCTAAG
CAAGAAGGCTCGGCAACAAGATTAACCTTAAAGAAATATTGTCCAAAATGTAACGCGCAC
ACAATTCATAAAGAATCGAAATAA60
120
144
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: SAUSA300_RS15115
- symbol: SAUSA300_RS15115
- description: 50S ribosomal protein L33
- length: 47
- theoretical pI: 10.0872
- theoretical MW: 5375.25
- GRAVY: -1.03617
⊟Function[edit | edit source]
- TIGRFAM: Protein synthesis Ribosomal proteins: synthesis and modification ribosomal protein bL33 (TIGR01023; HMM-score: 51.7)
- TheSEED:
- PFAM: Zn_Beta_Ribbon (CL0167) Ribosomal_L33; Ribosomal protein L33 (PF00471; HMM-score: 60)and 14 moreNOB1_Zn_bind; Nin one binding (NOB1) Zn-ribbon like (PF08772; HMM-score: 17.6)DZR; Double zinc ribbon (PF12773; HMM-score: 16.1)Ribosomal_L37e; Ribosomal protein L37e (PF01907; HMM-score: 15.6)Zn-ribbon_8; Zinc ribbon domain (PF09723; HMM-score: 15.2)no clan defined Nop10p; Nucleolar RNA-binding protein, Nop10p family (PF04135; HMM-score: 14.5)Zn_Beta_Ribbon (CL0167) zf-ribbon_3; zinc-ribbon domain (PF13248; HMM-score: 14.4)zf-C4_Topoisom; Topoisomerase DNA binding C4 zinc finger (PF01396; HMM-score: 14.3)Nudix_N_2; Nudix N-terminal (PF14803; HMM-score: 14.2)no clan defined HypA; Hydrogenase/urease nickel incorporation, metallochaperone, hypA (PF01155; HMM-score: 13.6)DUF983; Protein of unknown function (DUF983) (PF06170; HMM-score: 12.3)Zn_Beta_Ribbon (CL0167) zf-RRN7; Zinc-finger of RNA-polymerase I-specific TFIIB, Rrn7 (PF11781; HMM-score: 12.1)no clan defined VP_N-CPKC; Virion protein N terminal domain (PF11475; HMM-score: 12)ADK_lid; Adenylate kinase, active site lid (PF05191; HMM-score: 11.5)Zn_Beta_Ribbon (CL0167) zf-NADH-PPase; NADH pyrophosphatase zinc ribbon domain (PF09297; HMM-score: 10.2)
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
⊟Localization[edit | edit source]
- PSORTb: Cytoplasmic
- Cytoplasmic Score: 9.67
- Cytoplasmic Membrane Score: 0.01
- Cellwall Score: 0.15
- Extracellular Score: 0.17
- Internal Helices: 0
- LocateP:
- SignalP: no predicted signal peptide
- SP(Sec/SPI): 0.269171
- TAT(Tat/SPI): 0.008157
- LIPO(Sec/SPII): 0.045224
- predicted transmembrane helices (TMHMM): 0
⊟Accession numbers[edit | edit source]
- GI:
- RefSeq: WP_001788193 NCBI
- UniProt:
⊟Protein sequence[edit | edit source]
- MRKIPLNCEACGNRNYNVPKQEGSATRLTLKKYCPKCNAHTIHKESK
⊟Experimental data[edit | edit source]
- experimentally validated:
- protein localization:
- quantitative data / protein copy number per cell:
- interaction partners:
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
⊟Regulation[edit | edit source]
- regulator:
⊟Transcription pattern[edit | edit source]
- S.aureus Expression Data Browser: no data available
⊟Protein synthesis (provided by Aureolib)[edit | edit source]
- Aureolib: no data available
⊟Protein stability[edit | edit source]
- half-life: no data available
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Other Information[edit | edit source]
You are kindly invited to share additional interesting facts.
⊟Literature[edit | edit source]
⊟References[edit | edit source]
⊟Relevant publications[edit | edit source]