Jump to navigation
Jump to search
COLN315NCTC8325NewmanUSA300_FPR375704-0298108BA0217611819-97685071193ECT-R 2ED133ED98HO 5096 0412JH1JH9JKD6008JKD6159LGA251M013MRSA252MSHR1132MSSA476MW2Mu3Mu50RF122ST398T0131TCH60TW20USA300_TCH1516VC40
NCBI: 02-MAR-2017
⊟Summary[edit | edit source]
- organism: Staphylococcus aureus USA300_FPR3757
- locus tag: SAUSA300_RS15255
- pan locus tag?:
- symbol: SAUSA300_RS15255
- pan gene symbol?: —
- synonym:
- product: lactococcin 972 family bacteriocin
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: SAUSA300_RS15255
- symbol: SAUSA300_RS15255
- product: lactococcin 972 family bacteriocin
- replicon: chromosome
- strand: +
- coordinates: 1023151..1023423
- length: 273
- essential: unknown
⊟Accession numbers[edit | edit source]
⊟Phenotype[edit | edit source]
Share your knowledge and add information here. [edit]
⊟DNA sequence[edit | edit source]
- 1
61
121
181
241ATTTTTGGCACTATATTATATTTAACTTTAGCACTTGGATTATCAACAGCAGCTTATGCA
TCTACAGAATACGCAGAAGGAGGCACTTGGAGTCATGGTGTCGGCAGTAAGTATGTTTGG
TCGTATTATTATCATGGTCATAAAGGACATGGTGCAACAGCTATTGGAAAATATAGATCA
TTTAGTGGTTATACAAGAGCTGGTGTAAAAGCAAAAGCATCAGCTACTAAACATAATTGG
TGGGTCAATAGAGCGTATTATAACATTTATTAA60
120
180
240
273
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: SAUSA300_RS15255
- symbol: SAUSA300_RS15255
- description: lactococcin 972 family bacteriocin
- length: 90
- theoretical pI: 9.98793
- theoretical MW: 10015.1
- GRAVY: -0.311111
⊟Function[edit | edit source]
- TIGRFAM: Cellular processes Toxin production and resistance bacteriocin, lactococcin 972 family (TIGR01653; HMM-score: 35.7)
- TheSEED:
- PFAM: no clan defined Lactococcin_972; Bacteriocin (Lactococcin_972) (PF09683; HMM-score: 48.6)
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
⊟Localization[edit | edit source]
- PSORTb: unknown (no significant prediction)
- Cytoplasmic Score: 0
- Cytoplasmic Membrane Score: 3.33
- Cellwall Score: 3.33
- Extracellular Score: 3.33
- Internal Helix: 1
- LocateP:
- SignalP: Signal peptide SP(Sec/SPI) length 20 aa
- SP(Sec/SPI): 0.978106
- TAT(Tat/SPI): 0.00649
- LIPO(Sec/SPII): 0.011467
- Cleavage Site: CS pos: 20-21. AYA-ST. Pr: 0.7652
- predicted transmembrane helices (TMHMM): 0
⊟Accession numbers[edit | edit source]
- GI:
- RefSeq: WP_001790097 NCBI
- UniProt:
⊟Protein sequence[edit | edit source]
- MFGTILYLTLALGLSTAAYASTEYAEGGTWSHGVGSKYVWSYYYHGHKGHGATAIGKYRSFSGYTRAGVKAKASATKHNWWVNRAYYNIY
⊟Experimental data[edit | edit source]
- experimentally validated:
- protein localization:
- quantitative data / protein copy number per cell:
- interaction partners:
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
⊟Regulation[edit | edit source]
- regulator:
⊟Transcription pattern[edit | edit source]
- S.aureus Expression Data Browser: no data available
⊟Protein synthesis (provided by Aureolib)[edit | edit source]
- Aureolib: no data available
⊟Protein stability[edit | edit source]
- half-life: no data available
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Other Information[edit | edit source]
You are kindly invited to share additional interesting facts.