Jump to navigation
Jump to search
COLN315NCTC8325NewmanUSA300_FPR375704-0298108BA0217611819-97685071193ECT-R 2ED133ED98HO 5096 0412JH1JH9JKD6008JKD6159LGA251M013MRSA252MSHR1132MSSA476MW2Mu3Mu50RF122ST398T0131TCH60TW20USA300_TCH1516VC40
NCBI: 02-MAR-2017
⊟Summary[edit | edit source]
- organism: Staphylococcus aureus USA300_FPR3757
- locus tag: SAUSA300_RS15675
- pan locus tag?:
- symbol: SAUSA300_RS15675
- pan gene symbol?: —
- synonym:
- product: hypothetical protein
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: SAUSA300_RS15675
- symbol: SAUSA300_RS15675
- product: hypothetical protein
- replicon: chromosome
- strand: +
- coordinates: 2866643..2866792
- length: 150
- essential: unknown
⊟Accession numbers[edit | edit source]
⊟Phenotype[edit | edit source]
Share your knowledge and add information here. [edit]
⊟DNA sequence[edit | edit source]
- 1
61
121ATGATATTTTCGCAAAATTTATTTCGTCGTCCCACCCCAGCAAGGTTGACTAGAATTGAA
AAAAGCTTGTTACAAGCGCATTTTCGTTCAGTCAACTACTGCCAATATAACTTCGTAGAG
CATAGAACATTGATTTATGTACCAGCCTGA60
120
150
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: SAUSA300_RS15675
- symbol: SAUSA300_RS15675
- description: hypothetical protein
- length: 49
- theoretical pI: 10.7422
- theoretical MW: 5926.87
- GRAVY: -0.253061
⊟Function[edit | edit source]
- TIGRFAM:
- TheSEED:
- PFAM: no clan defined DUF3125; Protein of unknown function (DUF3125) (PF11323; HMM-score: 52.6)
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
⊟Localization[edit | edit source]
⊟Accession numbers[edit | edit source]
- GI:
- RefSeq: WP_001617169 NCBI
- UniProt:
⊟Protein sequence[edit | edit source]
- MIFSQNLFRRPTPARLTRIEKSLLQAHFRSVNYCQYNFVEHRTLIYVPA
⊟Experimental data[edit | edit source]
- experimentally validated:
- protein localization:
- quantitative data / protein copy number per cell:
- interaction partners:
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
⊟Regulation[edit | edit source]
- regulator:
⊟Transcription pattern[edit | edit source]
- S.aureus Expression Data Browser: no data available
⊟Protein synthesis (provided by Aureolib)[edit | edit source]
- Aureolib: no data available
⊟Protein stability[edit | edit source]
- half-life: no data available