From AureoWiki
Jump to navigation Jump to search
COLN315NCTC8325NewmanUSA300_FPR3757JSNZ04-0298108BA0217611819-97685071193ECT-R 2ED133ED98HO 5096 0412JH1JH9JKD6008JKD6159LGA251M013MRSA252MSHR1132MSSA476MW2Mu3Mu50RF122ST398T0131TCH60TW20USA300_TCH1516VC40

NCBI: 02-MAR-2017

Summary[edit | edit source]

  • organism: Staphylococcus aureus USA300_FPR3757
  • locus tag: SAUSA300_RS15680
  • pan locus tag?:
  • symbol: SAUSA300_RS15680
  • pan gene symbol?:
  • synonym:
  • product: hypothetical protein

Genome View[edit | edit source]

Gene[edit | edit source]

General[edit | edit source]

  • type: CDS
  • locus tag: SAUSA300_RS15680
  • symbol: SAUSA300_RS15680
  • product: hypothetical protein
  • replicon: pUSA01
  • strand: -
  • coordinates: 1003..1194
  • length: 192
  • essential: unknown

Accession numbers[edit | edit source]

  • Location: NC_007790 (1003..1194) NCBI
  • BioCyc: SAUSA300_RS15680 BioCyc
  • MicrobesOnline:

Phenotype[edit | edit source]

Share your knowledge and add information here. [edit]

DNA sequence[edit | edit source]

  • 1
    61
    121
    181
    ATGATAGGTCTGGCAAAGCCAGAAATTCCAGGGGTTTTAAGGTATTTTAAAGTGATATCA
    TACAAAGCTGTACTGTCTTATTTTTGTGACACAATATATTGCGTTTGTCTTATTTTTGTG
    ACACTACATACAGCATTTGTCACAAAAATAAGACAGTACTTTTTTATAAAAAATCAACAA
    AAAAGACATTAG
    60
    120
    180
    192

Protein[edit | edit source]

General[edit | edit source]

  • locus tag: SAUSA300_RS15680
  • symbol: SAUSA300_RS15680
  • description: hypothetical protein
  • length: 63
  • theoretical pI: 10.0181
  • theoretical MW: 7464.97
  • GRAVY: 0.446032

Function[edit | edit source]

  • TIGRFAM:
  • TheSEED:
  • PFAM:

Structure, modifications & cofactors[edit | edit source]

  • domains:
  • modifications:
  • cofactors:
  • effectors:

Localization[edit | edit source]

  • PSORTb: unknown (no significant prediction)
    • Cytoplasmic Score: 2.5
    • Cytoplasmic Membrane Score: 2.5
    • Cellwall Score: 2.5
    • Extracellular Score: 2.5
    • Internal Helix: 1
  • DeepLocPro: Extracellular
    • Cytoplasmic Score: 0.4786
    • Cytoplasmic Membrane Score: 0.0008
    • Cell wall & surface Score: 0.0001
    • Extracellular Score: 0.5205
  • LocateP:
  • SignalP: no predicted signal peptide
    • SP(Sec/SPI): 0.006042
    • TAT(Tat/SPI): 0.00015
    • LIPO(Sec/SPII): 0.015693
  • predicted transmembrane helices (TMHMM): 1

Accession numbers[edit | edit source]

  • GI:
  • RefSeq: WP_001791934 NCBI
  • UniProt:

Protein sequence[edit | edit source]

  • MIGLAKPEIPGVLRYFKVISYKAVLSYFCDTIYCVCLIFVTLHTAFVTKIRQYFFIKNQQKRH

Experimental data[edit | edit source]

  • experimentally validated:
  • protein localization:
  • quantitative data / protein copy number per cell:
  • interaction partners:

Expression & Regulation[edit | edit source]

Operon[edit | edit source]

Regulation[edit | edit source]

  • regulator:

Transcription pattern[edit | edit source]

Protein synthesis (provided by Aureolib)[edit | edit source]

Protein stability[edit | edit source]

  • half-life: no data available

Biological Material[edit | edit source]

Mutants[edit | edit source]

Expression vector[edit | edit source]

lacZ fusion[edit | edit source]

GFP fusion[edit | edit source]

two-hybrid system[edit | edit source]

FLAG-tag construct[edit | edit source]

Antibody[edit | edit source]

Other Information[edit | edit source]

You can add further information about the gene and protein here. [edit]

Literature[edit | edit source]

References[edit | edit source]

Relevant publications[edit | edit source]