From AureoWiki
Jump to navigation Jump to search
COLN315NCTC8325NewmanUSA300_FPR3757JSNZ04-0298108BA0217611819-97685071193ECT-R 2ED133ED98HO 5096 0412JH1JH9JKD6008JKD6159LGA251M013MRSA252MSHR1132MSSA476MW2Mu3Mu50RF122ST398T0131TCH60TW20USA300_TCH1516VC40

NCBI: 23-MAY-2013

Summary[edit | edit source]

  • organism: Staphylococcus aureus USA300_FPR3757
  • locus tag: SAUSA300_pUSA010003 [new locus tag: SAUSA300_RS14710 ]
  • pan locus tag?:
  • symbol: SAUSA300_pUSA010003
  • pan gene symbol?:
  • synonym:
  • product: hypothetical protein

Genome View[edit | edit source]

Gene[edit | edit source]

General[edit | edit source]

  • type: CDS
  • locus tag: SAUSA300_pUSA010003 [new locus tag: SAUSA300_RS14710 ]
  • symbol: SAUSA300_pUSA010003
  • product: hypothetical protein
  • replicon: pUSA01
  • strand: +
  • coordinates: 1546..1767
  • length: 222
  • essential: unknown

Accession numbers[edit | edit source]

Phenotype[edit | edit source]

Share your knowledge and add information here. [edit]

DNA sequence[edit | edit source]

  • 1
    61
    121
    181
    GTGATAAAGTTTTTTAAAAAAGGAGTGTTTATTTTGAATAAAAACACAGTGTTAGATGAA
    GGTTACGTTATAGCAACTATTTTAAATGTTTTCTTTTTACTTGGATTAATTTTTATATCT
    CATTTGGAAAATTTATATATATTAATTCCGTATGTTATTTTGATGGGAATAAATGCTATT
    TATTTGGTTGTTAAGGTTATGAATTTCAAAAAGAATAATTAG
    60
    120
    180
    222

Protein[edit | edit source]

General[edit | edit source]

  • locus tag: SAUSA300_pUSA010003 [new locus tag: SAUSA300_RS14710 ]
  • symbol: SAUSA300_pUSA010003
  • description: hypothetical protein
  • length: 73
  • theoretical pI: 10.0707
  • theoretical MW: 8454.32
  • GRAVY: 1.01644

Function[edit | edit source]

  • TIGRFAM:
  • TheSEED  :
    • FIG01109567: hypothetical protein
  • PFAM:
    BPD_transp_1 (CL0404) DUF1430; Protein of unknown function (DUF1430) (PF07242; HMM-score: 16.3)
    and 1 more
    no clan defined DUF2207_C; Predicted membrane protein (DUF2207) C-terminal domain (PF20990; HMM-score: 11)

Structure, modifications & cofactors[edit | edit source]

  • domains:
  • modifications:
  • cofactors:
  • effectors:

Localization[edit | edit source]

  • PSORTb: Cytoplasmic Membrane
    • Cytoplasmic Score: 0.32
    • Cytoplasmic Membrane Score: 9.55
    • Cellwall Score: 0.12
    • Extracellular Score: 0.01
    • Internal Helices: 2
  • DeepLocPro: Cytoplasmic Membrane
    • Cytoplasmic Score: 0.0004
    • Cytoplasmic Membrane Score: 0.9539
    • Cell wall & surface Score: 0
    • Extracellular Score: 0.0457
  • LocateP: Multi-transmembrane
    • Prediction by SwissProt Classification: Membrane
    • Pathway Prediction: Possibly Tat-/Sec-(SPI)
    • Intracellular possibility: 0.17
    • Signal peptide possibility: -1
    • N-terminally Anchored Score: 1
    • Predicted Cleavage Site: No CleavageSite
  • SignalP: no predicted signal peptide
    • SP(Sec/SPI): 0.000776
    • TAT(Tat/SPI): 0.000042
    • LIPO(Sec/SPII): 0.002042
  • predicted transmembrane helices (TMHMM): 2

Accession numbers[edit | edit source]

Protein sequence[edit | edit source]

  • MIKFFKKGVFILNKNTVLDEGYVIATILNVFFLLGLIFISHLENLYILIPYVILMGINAIYLVVKVMNFKKNN

Experimental data[edit | edit source]

  • experimentally validated:
  • protein localization:
  • quantitative data / protein copy number per cell:
  • interaction partners:

Expression & Regulation[edit | edit source]

Operon[edit | edit source]

Regulation[edit | edit source]

  • regulator:

Transcription pattern[edit | edit source]

Protein synthesis (provided by Aureolib)[edit | edit source]

Protein stability[edit | edit source]

  • half-life: no data available

Biological Material[edit | edit source]

Mutants[edit | edit source]

Expression vector[edit | edit source]

lacZ fusion[edit | edit source]

GFP fusion[edit | edit source]

two-hybrid system[edit | edit source]

FLAG-tag construct[edit | edit source]

Antibody[edit | edit source]

Other Information[edit | edit source]

You can add further information about the gene and protein here. [edit]

Literature[edit | edit source]

References[edit | edit source]

Relevant publications[edit | edit source]