From AureoWiki
Jump to navigation Jump to search
COLN315NCTC8325NewmanUSA300_FPR375704-0298108BA0217611819-97685071193ECT-R 2ED133ED98HO 5096 0412JH1JH9JKD6008JKD6159LGA251M013MRSA252MSHR1132MSSA476MW2Mu3Mu50RF122ST398T0131TCH60TW20USA300_TCH1516VC40

NCBI: 02-MAR-2017

Summary[edit | edit source]

  • organism: Staphylococcus aureus N315
  • locus tag: SA_RS00040 [old locus tag: SAP010 ]
  • pan locus tag?:
  • symbol: SA_RS00040
  • pan gene symbol?:
  • synonym:
  • product: class A beta-lactamase BlaZ

Genome View[edit | edit source]

Gene[edit | edit source]

General[edit | edit source]

  • type: CDS
  • locus tag: SA_RS00040 [old locus tag: SAP010 ]
  • symbol: SA_RS00040
  • product: class A beta-lactamase BlaZ
  • replicon: pN315
  • strand: -
  • coordinates: 7945..8790
  • length: 846
  • essential: unknown

Accession numbers[edit | edit source]

  • Location: NC_003140 (7945..8790) NCBI
  • BioCyc: G1G21-2918 BioCyc
  • MicrobesOnline:

Phenotype[edit | edit source]

Share your knowledge and add information here. [edit]

DNA sequence[edit | edit source]

  • 1
    61
    121
    181
    241
    301
    361
    421
    481
    541
    601
    661
    721
    781
    841
    TTGAAAAAGTTAATATTTTTAATTGTAATTGCTTTAGTTTTAAGTGCATGTAATTCAAAC
    AGTTCACATGCCAAAGAGTTAAATGATTTAGAAAAAAAATATAATGCTCATATTGGTGTT
    TATGCTTTAGATACTAAAAGTGGTAAGGAAGTAAAATTTAATTCAGATAAGAGATTTGCC
    TATGCTTCGACTTCAAAAGCGATAAATAGTGCTATTTTGTTAGAACAAGTACCTTATAAT
    AAGTTAAATAAAAAAGTACATATTAACAAAGATGATATAGTTGCTTATTCTCCTATTTTA
    GAAAAATATGTAGGAAAAGATATCACTTTAAAAGAACTTATTGAGGCTTCAATGACATAT
    AGTGATAATACAGCAAACAATAAAATTATAAAAGAAATCGGTGGAATCAAAAAAGTTAAA
    CAACGTCTAAAAGAACTAGGAGATAAAGTAACAAATCCAGTTAGATATGAGATAGAATTA
    AATTACTATTCACCAAAGAGCAAAAAAGATACTTCAACGCCTGCTGCTTTCGGCAAGACT
    TTAAATAAACTTATCGCAAATGGAAAATTAAGCAAAAAAAATAAAAATTTCTTACTTGAT
    TTAATGTTTAATAATAAAAACGGAGACACTTTAATTAAAGATGGTGTTCCAAAAGACTAT
    AAGGTTGCTGATAAAAGTGGTCAAGCAATAACATATGCTTCTAGAAATGATGTTGCTTTT
    GTTTATCCTAAGGGCCAATCTGAACCTATTGTTTTAGTCATTTTTACGAATAAAGACAAT
    AAAAGTGATAAGCCAAATGATAAGTTGATAAGTGAAACCGCCAAGAGTGTAATGAAGGAA
    TTTTAA
    60
    120
    180
    240
    300
    360
    420
    480
    540
    600
    660
    720
    780
    840
    846

Protein[edit | edit source]

General[edit | edit source]

  • locus tag: SA_RS00040 [old locus tag: SAP010 ]
  • symbol: SA_RS00040
  • description: class A beta-lactamase BlaZ
  • length: 281
  • theoretical pI: 10.1468
  • theoretical MW: 31453.1
  • GRAVY: -0.492883

Function[edit | edit source]

  • reaction:
    EC 3.5.2.6?  ExPASy
    Beta-lactamase A beta-lactam + H2O = a substituted beta-amino acid
  • TIGRFAM:
  • TheSEED:
  • PFAM:
    Beta-lactamase (CL0013) Beta-lactamase2; Beta-lactamase enzyme family (PF13354; HMM-score: 127)
    and 3 more
    Beta-lactamase; Beta-lactamase (PF00144; HMM-score: 77.7)
    Peptidase_S11; D-alanyl-D-alanine carboxypeptidase (PF00768; HMM-score: 17.3)
    no clan defined FadA; Adhesion protein FadA (PF09403; HMM-score: 11.3)

Structure, modifications & interactions[edit | edit source]

  • domains:
  • modifications:
  • cofactors:
  • effectors:
  • protein partners:

Localization[edit | edit source]

  • PSORTb: Cellwall
    • Cytoplasmic Score: 0.01
    • Cytoplasmic Membrane Score: 0.53
    • Cellwall Score: 8.75
    • Extracellular Score: 0.7
    • Internal Helices: 0
  • LocateP:
  • SignalP: Signal peptide LIPO(Sec/SPII) length 16 aa
    • SP(Sec/SPI): 0.033339
    • TAT(Tat/SPI): 0.000123
    • LIPO(Sec/SPII): 0.966298
    • Cleavage Site: CS pos: 16-17. LSA-CN. Pr: 0.9681
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit | edit source]

  • GI: 446655939 NCBI
  • RefSeq: WP_000733285 NCBI
  • UniProt:

Protein sequence[edit | edit source]

  • MKKLIFLIVIALVLSACNSNSSHAKELNDLEKKYNAHIGVYALDTKSGKEVKFNSDKRFAYASTSKAINSAILLEQVPYNKLNKKVHINKDDIVAYSPILEKYVGKDITLKELIEASMTYSDNTANNKIIKEIGGIKKVKQRLKELGDKVTNPVRYEIELNYYSPKSKKDTSTPAAFGKTLNKLIANGKLSKKNKNFLLDLMFNNKNGDTLIKDGVPKDYKVADKSGQAITYASRNDVAFVYPKGQSEPIVLVIFTNKDNKSDKPNDKLISETAKSVMKEF

Experimental data[edit | edit source]

  • experimentally validated: no data available

Expression & Regulation[edit | edit source]

Operon[edit | edit source]

Regulation[edit | edit source]

  • regulator:

Transcription pattern[edit | edit source]

Protein synthesis (provided by Aureolib)[edit | edit source]

Protein stability[edit | edit source]

  • half-life: no data available

Biological Material[edit | edit source]

Mutants[edit | edit source]

Expression vector[edit | edit source]

lacZ fusion[edit | edit source]

GFP fusion[edit | edit source]

two-hybrid system[edit | edit source]

FLAG-tag construct[edit | edit source]

Antibody[edit | edit source]

Other Information[edit | edit source]

You are kindly invited to share additional interesting facts.

Literature[edit | edit source]

References[edit | edit source]

Relevant publications[edit | edit source]