From AureoWiki
Jump to navigation Jump to search
COLN315NCTC8325NewmanUSA300_FPR375704-0298108BA0217611819-97685071193ECT-R 2ED133ED98HO 5096 0412JH1JH9JKD6008JKD6159JSNZLGA251M013MRSA252MSHR1132MSSA476MW2Mu3Mu50RF122ST398T0131TCH60TW20USA300_TCH1516VC40

NCBI: 02-MAR-2017

Summary[edit | edit source]

  • organism: Staphylococcus aureus N315
  • locus tag: SA_RS00085 [old locus tag: SAP019 ]
  • pan locus tag?:
  • symbol: SA_RS00085
  • pan gene symbol?:
  • synonym:
  • product: lactococcin 972 family bacteriocin

Genome View[edit | edit source]

Gene[edit | edit source]

General[edit | edit source]

  • type: CDS
  • locus tag: SA_RS00085 [old locus tag: SAP019 ]
  • symbol: SA_RS00085
  • product: lactococcin 972 family bacteriocin
  • replicon: pN315
  • strand: +
  • coordinates: 16503..16796
  • length: 294
  • essential: unknown

Accession numbers[edit | edit source]

  • Location: NC_003140 (16503..16796) NCBI
  • BioCyc: SA_RS00085 BioCyc
  • MicrobesOnline: see SAP019

Phenotype[edit | edit source]

Share your knowledge and add information here. [edit]

DNA sequence[edit | edit source]

  • 1
    61
    121
    181
    241
    ATGAAAAAGAAATTTGTTTCTAGTTGTATTGCTAGTACAATCTTATTCGGCACTTTATTA
    GGTGTAACTTATAAAGCTGAAGCTGCAACAGTACATGTAGCTGGTGGTGTTTGGAGCCAT
    GGTATTGGAAAACATTACGTATGGTCTTATTATAGTCACAATAAAAGAAATCATGGTTCA
    ACAGCAGTAGGGAAATATTCATCTTTTAGTGGTGTTGCTCGACCTGGTGTTCAATCTAAG
    GCATCTGCTCCAAAGGCTTGGGGTGGAAACAAAACATTTTATAGTCTTCACTAA
    60
    120
    180
    240
    294

Protein[edit | edit source]

General[edit | edit source]

  • locus tag: SA_RS00085 [old locus tag: SAP019 ]
  • symbol: SA_RS00085
  • description: lactococcin 972 family bacteriocin
  • length: 97
  • theoretical pI: 10.6702
  • theoretical MW: 10407.8
  • GRAVY: -0.182474

Function[edit | edit source]

  • TIGRFAM:
    Cellular processes Cellular processes Toxin production and resistance bacteriocin, lactococcin 972 family (TIGR01653; HMM-score: 105.4)
  • TheSEED: see SAP019
  • PFAM:
    no clan defined Lactococcin_972; Bacteriocin (Lactococcin_972) (PF09683; HMM-score: 52.2)
    and 1 more
    CyanoTRADDas_TM; Cyanobacterial TRADD-N associated 2-Transmembrane domain (PF20712; HMM-score: 15.1)

Structure, modifications & cofactors[edit | edit source]

  • domains:
  • modifications:
  • cofactors:
  • effectors:

Localization[edit | edit source]

  • PSORTb: Cytoplasmic Membrane
    • Cytoplasmic Score: 0
    • Cytoplasmic Membrane Score: 9.87
    • Cellwall Score: 0.12
    • Extracellular Score: 0.01
    • Internal Helices: 0
  • DeepLocPro: Extracellular
    • Cytoplasmic Score: 0
    • Cytoplasmic Membrane Score: 0
    • Cell wall & surface Score: 0.0002
    • Extracellular Score: 0.9998
  • LocateP:
  • SignalP: Signal peptide SP(Sec/SPI) length 28 aa
    • SP(Sec/SPI): 0.995707
    • TAT(Tat/SPI): 0.001301
    • LIPO(Sec/SPII): 0.000947
    • Cleavage Site: CS pos: 28-29. AEA-AT. Pr: 0.9795
  • predicted transmembrane helices (TMHMM): 1

Accession numbers[edit | edit source]

Protein sequence[edit | edit source]

  • MKKKFVSSCIASTILFGTLLGVTYKAEAATVHVAGGVWSHGIGKHYVWSYYSHNKRNHGSTAVGKYSSFSGVARPGVQSKASAPKAWGGNKTFYSLH

Experimental data[edit | edit source]

  • experimentally validated:
  • protein localization:
  • quantitative data / protein copy number per cell:
  • interaction partners:

Expression & Regulation[edit | edit source]

Operon[edit | edit source]

Regulation[edit | edit source]

  • regulator:

Transcription pattern[edit | edit source]

Protein synthesis (provided by Aureolib)[edit | edit source]

Protein stability[edit | edit source]

  • half-life: no data available

Biological Material[edit | edit source]

Mutants[edit | edit source]

Expression vector[edit | edit source]

lacZ fusion[edit | edit source]

GFP fusion[edit | edit source]

two-hybrid system[edit | edit source]

FLAG-tag construct[edit | edit source]

Antibody[edit | edit source]

Other Information[edit | edit source]

You are kindly invited to share additional interesting facts.

Literature[edit | edit source]

References[edit | edit source]

Relevant publications[edit | edit source]