From AureoWiki
Jump to navigation Jump to search
COLN315NCTC8325NewmanUSA300_FPR3757JSNZ04-0298108BA0217611819-97685071193ECT-R 2ED133ED98HO 5096 0412JH1JH9JKD6008JKD6159LGA251M013MRSA252MSHR1132MSSA476MW2Mu3Mu50RF122ST398T0131TCH60TW20USA300_TCH1516VC40

NCBI: 02-MAR-2017

Summary[edit | edit source]

  • organism: Staphylococcus aureus N315
  • locus tag: SA_RS00130 [old locus tag: SAP028 ]
  • pan locus tag?:
  • symbol: SA_RS00130
  • pan gene symbol?:
  • synonym:
  • product: transcriptional regulator

Genome View[edit | edit source]

Gene[edit | edit source]

General[edit | edit source]

  • type: CDS
  • locus tag: SA_RS00130 [old locus tag: SAP028 ]
  • symbol: SA_RS00130
  • product: transcriptional regulator
  • replicon: pN315
  • strand: +
  • coordinates: 22517..22756
  • length: 240
  • essential: unknown

Accession numbers[edit | edit source]

  • Location: NC_003140 (22517..22756) NCBI
  • BioCyc: SA_RS00130 BioCyc
  • MicrobesOnline: see SAP028

Phenotype[edit | edit source]

Share your knowledge and add information here. [edit]

DNA sequence[edit | edit source]

  • 1
    61
    121
    181
    ATGAAATTAGCTGAAGCTATAAAAGAACAGAGAGAATTAAAAAGATGGTCTCAAGAGGAA
    TTAGCCAATATATTAAAGGTTTCCAGACAAAGTGTTTCTAAATGGGAAAGTGCCAAAAAC
    TATCCTTCCTTAGATATTTTGATTGCTATGAGCGATTTATTTGGAATCTCTTTAGAGCAT
    TTAATTAAAGGAGATGCACGTTTTAAAAAAGTTATTTTAGAGGGAAATTATAGAGAGTAA
    60
    120
    180
    240

Protein[edit | edit source]

General[edit | edit source]

  • locus tag: SA_RS00130 [old locus tag: SAP028 ]
  • symbol: SA_RS00130
  • description: transcriptional regulator
  • length: 79
  • theoretical pI: 9.63142
  • theoretical MW: 9191.6
  • GRAVY: -0.444304

Function[edit | edit source]

  • TIGRFAM:
    Signal transduction Regulatory functions DNA interactions transcriptional regulator, y4mF family (TIGR03070; HMM-score: 37)
    and 4 more
    putative zinc finger/helix-turn-helix protein, YgiT family (TIGR03830; HMM-score: 27.4)
    Hypothetical proteins Conserved TIGR00270 family protein (TIGR00270; HMM-score: 24.6)
    RNA polymerase sigma factor, sigma-70 family (TIGR02937; HMM-score: 16.6)
    Signal transduction Regulatory functions DNA interactions DNA-binding protein, Tfx family (TIGR00721; HMM-score: 15.1)
  • TheSEED: see SAP028
  • PFAM:
    HTH (CL0123) HTH_3; Helix-turn-helix (PF01381; HMM-score: 59.4)
    and 16 more
    HTH_31; Helix-turn-helix domain (PF13560; HMM-score: 35.2)
    HTH_19; Helix-turn-helix domain (PF12844; HMM-score: 33.5)
    Phage_CI_repr; Bacteriophage CI repressor helix-turn-helix domain (PF07022; HMM-score: 27.8)
    HTH_26; Cro/C1-type HTH DNA-binding domain (PF13443; HMM-score: 23.3)
    HTH_Crp_2; Crp-like helix-turn-helix domain (PF13545; HMM-score: 18.9)
    HTH_37; Helix-turn-helix domain (PF13744; HMM-score: 18.3)
    P22_Cro; DNA-binding transcriptional regulator Cro (PF14549; HMM-score: 18)
    YdaS_toxin; Bacterial toxin YdaS (PF15943; HMM-score: 17.2)
    HTH_28; Helix-turn-helix domain (PF13518; HMM-score: 16.8)
    Sigma70_r4; Sigma-70, region 4 (PF04545; HMM-score: 16.2)
    Uteroglobin (CL0370) SCGB3A; Secretoglobin 3A (PF20490; HMM-score: 16)
    HTH (CL0123) HTH_11; HTH domain (PF08279; HMM-score: 15.2)
    HTH_25; Helix-turn-helix domain (PF13413; HMM-score: 15.2)
    HTH_23; Homeodomain-like domain (PF13384; HMM-score: 14.2)
    HTH_17; Helix-turn-helix domain (PF12728; HMM-score: 14.1)
    YfeC-like; Transcription regulator YfeC-like (PF07037; HMM-score: 13.6)

Structure, modifications & cofactors[edit | edit source]

  • domains:
  • modifications:
  • cofactors:
  • effectors:

Localization[edit | edit source]

  • PSORTb: Cytoplasmic
    • Cytoplasmic Score: 7.5
    • Cytoplasmic Membrane Score: 1.15
    • Cellwall Score: 0.62
    • Extracellular Score: 0.73
    • Internal Helices: 0
  • DeepLocPro: Cytoplasmic
    • Cytoplasmic Score: 0.9631
    • Cytoplasmic Membrane Score: 0.0086
    • Cell wall & surface Score: 0.0008
    • Extracellular Score: 0.0275
  • LocateP:
  • SignalP: no predicted signal peptide
    • SP(Sec/SPI): 0.002086
    • TAT(Tat/SPI): 0.000403
    • LIPO(Sec/SPII): 0.000407
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit | edit source]

Protein sequence[edit | edit source]

  • MKLAEAIKEQRELKRWSQEELANILKVSRQSVSKWESAKNYPSLDILIAMSDLFGISLEHLIKGDARFKKVILEGNYRE

Experimental data[edit | edit source]

  • experimentally validated:
  • protein localization:
  • quantitative data / protein copy number per cell:
  • interaction partners:

Expression & Regulation[edit | edit source]

Operon[edit | edit source]

Regulation[edit | edit source]

  • regulator:

Transcription pattern[edit | edit source]

Protein synthesis (provided by Aureolib)[edit | edit source]

Protein stability[edit | edit source]

  • half-life: no data available

Biological Material[edit | edit source]

Mutants[edit | edit source]

Expression vector[edit | edit source]

lacZ fusion[edit | edit source]

GFP fusion[edit | edit source]

two-hybrid system[edit | edit source]

FLAG-tag construct[edit | edit source]

Antibody[edit | edit source]

Other Information[edit | edit source]

You can add further information about the gene and protein here. [edit]

Literature[edit | edit source]

References[edit | edit source]

Relevant publications[edit | edit source]