From AureoWiki
Jump to navigation Jump to search
COLN315NCTC8325NewmanUSA300_FPR375704-0298108BA0217611819-97685071193ECT-R 2ED133ED98HO 5096 0412JH1JH9JKD6008JKD6159LGA251M013MRSA252MSHR1132MSSA476MW2Mu3Mu50RF122ST398T0131TCH60TW20USA300_TCH1516VC40

NCBI: 02-MAR-2017

Summary[edit | edit source]

  • organism: Staphylococcus aureus N315
  • locus tag: SA_RS01170
  • pan locus tag?:
  • symbol: SA_RS01170
  • pan gene symbol?:
  • synonym:
  • product: transcriptional regulator

Genome View[edit | edit source]

Gene[edit | edit source]

General[edit | edit source]

  • type: CDS
  • locus tag: SA_RS01170
  • symbol: SA_RS01170
  • product: transcriptional regulator
  • replicon: chromosome
  • strand: +
  • coordinates: 232638..232835
  • length: 198
  • essential: unknown

Accession numbers[edit | edit source]

  • Location: NC_002745 (232638..232835) NCBI
  • BioCyc: SA_RS01170 BioCyc
  • MicrobesOnline:

Phenotype[edit | edit source]

Share your knowledge and add information here. [edit]

DNA sequence[edit | edit source]

  • 1
    61
    121
    181
    GTGAAAAATAATTTGAAAATAGCTAGAGTTTCACTATCTATGACTCAAAAGGAGCTAGCA
    AATAAAGTTGGAGTAACTAGACAAACAATATCTCTTATAGAAAAGGGTGTACATAACCCC
    TCTCTATCACTATGTAAAAATATTTGTTCGGTGTTGAATAAAAATTTGGATGAGATATTT
    GGAGAGAAACCACAATAA
    60
    120
    180
    198

Protein[edit | edit source]

General[edit | edit source]

  • locus tag: SA_RS01170
  • symbol: SA_RS01170
  • description: transcriptional regulator
  • length: 65
  • theoretical pI: 10.3326
  • theoretical MW: 7223.46
  • GRAVY: -0.278462

Function[edit | edit source]

  • TIGRFAM:
    Signal transduction Regulatory functions DNA interactions transcriptional regulator, y4mF family (TIGR03070; HMM-score: 39.6)
    and 8 more
    putative zinc finger/helix-turn-helix protein, YgiT family (TIGR03830; HMM-score: 20.8)
    Unknown function General mobile mystery protein A (TIGR02612; HMM-score: 17.8)
    probable regulatory domain (TIGR03879; HMM-score: 17.4)
    Genetic information processing Mobile and extrachromosomal element functions Other addiction module antidote protein, HigA family (TIGR02607; HMM-score: 16.1)
    Signal transduction Regulatory functions DNA interactions addiction module antidote protein, HigA family (TIGR02607; HMM-score: 16.1)
    Signal transduction Regulatory functions Protein interactions addiction module antidote protein, HigA family (TIGR02607; HMM-score: 16.1)
    Signal transduction Regulatory functions DNA interactions DNA-binding protein, Tfx family (TIGR00721; HMM-score: 15.4)
    RNA polymerase sigma factor, sigma-70 family (TIGR02937; HMM-score: 13.5)
  • TheSEED:
  • PFAM:
    HTH (CL0123) HTH_3; Helix-turn-helix (PF01381; HMM-score: 58.1)
    and 17 more
    HTH_19; Helix-turn-helix domain (PF12844; HMM-score: 37.9)
    HTH_31; Helix-turn-helix domain (PF13560; HMM-score: 28.8)
    HTH_26; Cro/C1-type HTH DNA-binding domain (PF13443; HMM-score: 24.4)
    HTH_Crp_2; Crp-like helix-turn-helix domain (PF13545; HMM-score: 22.6)
    Sigma70_r4; Sigma-70, region 4 (PF04545; HMM-score: 19.1)
    YdaS_antitoxin; Putative antitoxin of bacterial toxin-antitoxin system, YdaS/YdaT (PF15943; HMM-score: 18.9)
    HTH_24; Winged helix-turn-helix DNA-binding (PF13412; HMM-score: 16.9)
    HTH_25; Helix-turn-helix domain (PF13413; HMM-score: 15.7)
    KORA; TrfB plasmid transcriptional repressor (PF16509; HMM-score: 14.9)
    Crp; Bacterial regulatory proteins, crp family (PF00325; HMM-score: 14.6)
    DUF1323; Putative transcription regulator (DUF1323) (PF07037; HMM-score: 14.3)
    MqsA_antitoxin; Antitoxin component of bacterial toxin-antitoxin system, MqsA (PF15731; HMM-score: 14)
    HTH_11; HTH domain (PF08279; HMM-score: 13.9)
    MarR; MarR family (PF01047; HMM-score: 13.5)
    HTH_28; Helix-turn-helix domain (PF13518; HMM-score: 13)
    HTH_AsnC-type; AsnC-type helix-turn-helix domain (PF13404; HMM-score: 11.6)
    no clan defined Pox_P4B; Poxvirus P4B major core protein (PF03292; HMM-score: 10.9)

Structure, modifications & cofactors[edit | edit source]

  • domains:
  • modifications:
  • cofactors:
  • effectors:

Localization[edit | edit source]

  • PSORTb: Cytoplasmic
    • Cytoplasmic Score: 7.5
    • Cytoplasmic Membrane Score: 1.15
    • Cellwall Score: 0.62
    • Extracellular Score: 0.73
    • Internal Helices: 0
  • LocateP:
  • SignalP: no predicted signal peptide
    • SP(Sec/SPI): 0.033077
    • TAT(Tat/SPI): 0.00135
    • LIPO(Sec/SPII): 0.004752
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit | edit source]

  • GI: 446717252 NCBI
  • RefSeq: WP_000794565 NCBI
  • UniProt:

Protein sequence[edit | edit source]

  • MKNNLKIARVSLSMTQKELANKVGVTRQTISLIEKGVHNPSLSLCKNICSVLNKNLDEIFGEKPQ

Experimental data[edit | edit source]

  • experimentally validated:
  • protein localization:
  • quantitative data / protein copy number per cell:
  • interaction partners:

Expression & Regulation[edit | edit source]

Operon[edit | edit source]

Regulation[edit | edit source]

  • regulator:

Transcription pattern[edit | edit source]

Protein synthesis (provided by Aureolib)[edit | edit source]

Protein stability[edit | edit source]

  • half-life: no data available

Biological Material[edit | edit source]

Mutants[edit | edit source]

Expression vector[edit | edit source]

lacZ fusion[edit | edit source]

GFP fusion[edit | edit source]

two-hybrid system[edit | edit source]

FLAG-tag construct[edit | edit source]

Antibody[edit | edit source]

Other Information[edit | edit source]

You are kindly invited to share additional interesting facts.

Literature[edit | edit source]

References[edit | edit source]

Relevant publications[edit | edit source]