Jump to navigation
Jump to search
COLN315NCTC8325NewmanUSA300_FPR375704-0298108BA0217611819-97685071193ECT-R 2ED133ED98HO 5096 0412JH1JH9JKD6008JKD6159LGA251M013MRSA252MSHR1132MSSA476MW2Mu3Mu50RF122ST398T0131TCH60TW20USA300_TCH1516VC40
NCBI: 02-MAR-2017
⊟Summary[edit | edit source]
- organism: Staphylococcus aureus N315
- locus tag: SA_RS01170
- pan locus tag?:
- symbol: SA_RS01170
- pan gene symbol?: —
- synonym:
- product: transcriptional regulator
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: SA_RS01170
- symbol: SA_RS01170
- product: transcriptional regulator
- replicon: chromosome
- strand: +
- coordinates: 232638..232835
- length: 198
- essential: unknown
⊟Accession numbers[edit | edit source]
⊟Phenotype[edit | edit source]
Share your knowledge and add information here. [edit]
⊟DNA sequence[edit | edit source]
- 1
61
121
181GTGAAAAATAATTTGAAAATAGCTAGAGTTTCACTATCTATGACTCAAAAGGAGCTAGCA
AATAAAGTTGGAGTAACTAGACAAACAATATCTCTTATAGAAAAGGGTGTACATAACCCC
TCTCTATCACTATGTAAAAATATTTGTTCGGTGTTGAATAAAAATTTGGATGAGATATTT
GGAGAGAAACCACAATAA60
120
180
198
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: SA_RS01170
- symbol: SA_RS01170
- description: transcriptional regulator
- length: 65
- theoretical pI: 10.3326
- theoretical MW: 7223.46
- GRAVY: -0.278462
⊟Function[edit | edit source]
- TIGRFAM: Regulatory functions DNA interactions transcriptional regulator, y4mF family (TIGR03070; HMM-score: 39.6)and 8 moreputative zinc finger/helix-turn-helix protein, YgiT family (TIGR03830; HMM-score: 20.8)Unknown function General mobile mystery protein A (TIGR02612; HMM-score: 17.8)probable regulatory domain (TIGR03879; HMM-score: 17.4)Mobile and extrachromosomal element functions Other addiction module antidote protein, HigA family (TIGR02607; HMM-score: 16.1)Regulatory functions DNA interactions addiction module antidote protein, HigA family (TIGR02607; HMM-score: 16.1)Regulatory functions Protein interactions addiction module antidote protein, HigA family (TIGR02607; HMM-score: 16.1)Regulatory functions DNA interactions DNA-binding protein, Tfx family (TIGR00721; HMM-score: 15.4)RNA polymerase sigma factor, sigma-70 family (TIGR02937; HMM-score: 13.5)
- TheSEED:
- PFAM: HTH (CL0123) HTH_3; Helix-turn-helix (PF01381; HMM-score: 58.1)and 17 moreHTH_19; Helix-turn-helix domain (PF12844; HMM-score: 37.9)HTH_31; Helix-turn-helix domain (PF13560; HMM-score: 28.8)HTH_26; Cro/C1-type HTH DNA-binding domain (PF13443; HMM-score: 24.4)HTH_Crp_2; Crp-like helix-turn-helix domain (PF13545; HMM-score: 22.6)Sigma70_r4; Sigma-70, region 4 (PF04545; HMM-score: 19.1)YdaS_antitoxin; Putative antitoxin of bacterial toxin-antitoxin system, YdaS/YdaT (PF15943; HMM-score: 18.9)HTH_24; Winged helix-turn-helix DNA-binding (PF13412; HMM-score: 16.9)HTH_25; Helix-turn-helix domain (PF13413; HMM-score: 15.7)KORA; TrfB plasmid transcriptional repressor (PF16509; HMM-score: 14.9)Crp; Bacterial regulatory proteins, crp family (PF00325; HMM-score: 14.6)DUF1323; Putative transcription regulator (DUF1323) (PF07037; HMM-score: 14.3)MqsA_antitoxin; Antitoxin component of bacterial toxin-antitoxin system, MqsA (PF15731; HMM-score: 14)HTH_11; HTH domain (PF08279; HMM-score: 13.9)MarR; MarR family (PF01047; HMM-score: 13.5)HTH_28; Helix-turn-helix domain (PF13518; HMM-score: 13)HTH_AsnC-type; AsnC-type helix-turn-helix domain (PF13404; HMM-score: 11.6)no clan defined Pox_P4B; Poxvirus P4B major core protein (PF03292; HMM-score: 10.9)
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
⊟Localization[edit | edit source]
- PSORTb: Cytoplasmic
- Cytoplasmic Score: 7.5
- Cytoplasmic Membrane Score: 1.15
- Cellwall Score: 0.62
- Extracellular Score: 0.73
- Internal Helices: 0
- LocateP:
- SignalP: no predicted signal peptide
- SP(Sec/SPI): 0.033077
- TAT(Tat/SPI): 0.00135
- LIPO(Sec/SPII): 0.004752
- predicted transmembrane helices (TMHMM): 0
⊟Accession numbers[edit | edit source]
⊟Protein sequence[edit | edit source]
- MKNNLKIARVSLSMTQKELANKVGVTRQTISLIEKGVHNPSLSLCKNICSVLNKNLDEIFGEKPQ
⊟Experimental data[edit | edit source]
- experimentally validated:
- protein localization:
- quantitative data / protein copy number per cell:
- interaction partners:
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
⊟Regulation[edit | edit source]
- regulator:
⊟Transcription pattern[edit | edit source]
- S.aureus Expression Data Browser: no data available
⊟Protein synthesis (provided by Aureolib)[edit | edit source]
- Aureolib: no data available
⊟Protein stability[edit | edit source]
- half-life: no data available
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Other Information[edit | edit source]
You are kindly invited to share additional interesting facts.