From AureoWiki
Jump to navigation Jump to search

Genome View[edit | edit source]

Gene[edit | edit source]

General[edit | edit source]

  • type: CDS
  • locus tag: SA_RS01565 [old locus tag: SA0266 ]
  • symbol: SA_RS01565
  • product: ABC transporter ATP-binding protein
  • replicon: chromosome
  • strand: -
  • coordinates: 321254..321913
  • length: 660
  • essential: no DEG other strains

Accession numbers[edit | edit source]

  • Location: NC_002745 (321254..321913) NCBI
  • BioCyc: SA_RS01565 BioCyc
  • MicrobesOnline: see SA0266

Phenotype[edit | edit source]

Share your knowledge and add information here. [edit]

DNA sequence[edit | edit source]

  • 1
    61
    121
    181
    241
    301
    361
    421
    481
    541
    601
    ATGATAGAAATTAATAATCTTTCAAAGCGTTACCGTAACAAACAGATTTTCAATCATTTA
    ACTATGTCCTTTGATAGTAATCGTTTAACCGTATTACTTGGTGATAATGGTGCTGGAAAA
    TCAACATTACTTCGTATGATTGCTGGTATTGAAAAAGCTAATGATGGAACTATCAACTAT
    TTCGGCGAAAAATGGAATCAAAGACAAATACAAAATCACATCGGTTATGTGCCACAAGAC
    ATTGCGTTATTTGAACACATGACAGTGGCTGAAAACATTAAATTTTTTAAATCACTTTGT
    AAAAATCCAATTAATGATACAACTATCAACGAATATTTACAGCAATTAAACTTTGATGAT
    ACGTCTGCCAAAGTATCTACATTGTCCGGTGGAAATAAACGTAAAATTAATATATTAGTA
    GGTTTACTAGGTCAACCTCGAATTCTCATTTTAGATGAACCGACAGTTGGTATTGATTTA
    AAATCTAGACATGACATCCACCAACTACTTAACATCATGAAATCTAAATGTTTAATTATA
    TTAACTACCCATCATTTAGATGAAGTGGAAGCACTTGCAGATGATATCAAGTTAATTGGC
    CAAGATCCTTTTTATCAACATGTTTTAGAGGACAAGCAATGGGCTTATACCTATTATTAA
    60
    120
    180
    240
    300
    360
    420
    480
    540
    600
    660

Protein[edit | edit source]

General[edit | edit source]

  • locus tag: SA_RS01565 [old locus tag: SA0266 ]
  • symbol: SA_RS01565
  • description: ABC transporter ATP-binding protein
  • length: 219
  • theoretical pI: 7.27079
  • theoretical MW: 25131.7
  • GRAVY: -0.319635

Function[edit | edit source]

  • TIGRFAM:
    Metabolism Transport and binding proteins Carbohydrates, organic alcohols, and acids ABC transporter, ATP-binding subunit, PQQ-dependent alcohol dehydrogenase system (TIGR03864; HMM-score: 143.2)
    lantibiotic protection ABC transporter, ATP-binding subunit (TIGR03740; HMM-score: 136.3)
    Metabolism Transport and binding proteins Other daunorubicin resistance ABC transporter, ATP-binding protein (TIGR01188; HMM-score: 135.2)
    Metabolism Transport and binding proteins Anions sulfate ABC transporter, ATP-binding protein (TIGR00968; EC 3.6.3.25; HMM-score: 124.5)
    Cellular processes Cellular processes Toxin production and resistance putative bacteriocin export ABC transporter, lactococcin 972 group (TIGR03608; HMM-score: 121.2)
    Metabolism Transport and binding proteins Unknown substrate putative bacteriocin export ABC transporter, lactococcin 972 group (TIGR03608; HMM-score: 121.2)
    Cell structure Cell envelope Biosynthesis and degradation of surface polysaccharides and lipopolysaccharides LPS export ABC transporter ATP-binding protein (TIGR04406; HMM-score: 115)
    Metabolism Transport and binding proteins Other LPS export ABC transporter ATP-binding protein (TIGR04406; HMM-score: 115)
    and 72 more
    gliding motility-associated ABC transporter ATP-binding subunit GldA (TIGR03522; HMM-score: 114.3)
    Metabolism Transport and binding proteins Amino acids, peptides and amines urea ABC transporter, ATP-binding protein UrtE (TIGR03410; HMM-score: 114.2)
    Genetic information processing Protein fate Protein and peptide secretion and trafficking heme ABC exporter, ATP-binding protein CcmA (TIGR01189; EC 3.6.3.41; HMM-score: 109.3)
    Metabolism Transport and binding proteins Other heme ABC exporter, ATP-binding protein CcmA (TIGR01189; EC 3.6.3.41; HMM-score: 109.3)
    Cellular processes Cellular processes Other nodulation ABC transporter NodI (TIGR01288; HMM-score: 108.5)
    Metabolism Transport and binding proteins Other nodulation ABC transporter NodI (TIGR01288; HMM-score: 108.5)
    Metabolism Transport and binding proteins Anions molybdate ABC transporter, ATP-binding protein (TIGR02142; EC 3.6.3.29; HMM-score: 106.9)
    Metabolism Transport and binding proteins Unknown substrate energy-coupling factor transporter ATPase (TIGR04521; EC 3.6.3.-; HMM-score: 105.9)
    Metabolism Transport and binding proteins Other rim ABC transporter (TIGR01257; HMM-score: 104.4)
    Cellular processes Cellular processes Cell division cell division ATP-binding protein FtsE (TIGR02673; HMM-score: 103.5)
    Metabolism Transport and binding proteins Amino acids, peptides and amines putative 2-aminoethylphosphonate ABC transporter, ATP-binding protein (TIGR03265; HMM-score: 101.7)
    Metabolism Transport and binding proteins Amino acids, peptides and amines polyamine ABC transporter, ATP-binding protein (TIGR01187; EC 3.6.3.31; HMM-score: 99.2)
    thiol reductant ABC exporter, CydD subunit (TIGR02857; HMM-score: 98.3)
    Metabolism Transport and binding proteins Unknown substrate energy-coupling factor transporter ATPase (TIGR04520; EC 3.6.3.-; HMM-score: 95.9)
    2-aminoethylphosphonate ABC transport system, ATP-binding component PhnT (TIGR03258; HMM-score: 92.4)
    Metabolism Transport and binding proteins Anions phosphate ABC transporter, ATP-binding protein (TIGR00972; EC 3.6.3.27; HMM-score: 91.2)
    Metabolism Transport and binding proteins Anions phosphonate ABC transporter, ATP-binding protein (TIGR02315; EC 3.6.3.28; HMM-score: 91.1)
    Genetic information processing Protein fate Protein and peptide secretion and trafficking type I secretion system ATPase (TIGR01842; HMM-score: 90.7)
    ABC exporter ATP-binding subunit, DevA family (TIGR02982; HMM-score: 90.5)
    Metabolism Transport and binding proteins Carbohydrates, organic alcohols, and acids D-xylose ABC transporter, ATP-binding protein (TIGR02633; EC 3.6.3.17; HMM-score: 88.6)
    Metabolism Transport and binding proteins Amino acids, peptides and amines urea ABC transporter, ATP-binding protein UrtD (TIGR03411; HMM-score: 88.2)
    Cellular processes Cellular processes Pathogenesis type I secretion system ATPase (TIGR03375; HMM-score: 87.5)
    Genetic information processing Protein fate Protein and peptide secretion and trafficking type I secretion system ATPase (TIGR03375; HMM-score: 87.5)
    proposed F420-0 ABC transporter, ATP-binding protein (TIGR03873; HMM-score: 87.2)
    ATP-binding cassette protein, ChvD family (TIGR03719; HMM-score: 85.2)
    Metabolism Transport and binding proteins Cations and iron carrying compounds cobalt ABC transporter, ATP-binding protein (TIGR01166; HMM-score: 81.2)
    Metabolism Transport and binding proteins Other pigment precursor permease (TIGR00955; HMM-score: 80)
    Genetic information processing Protein fate Protein and peptide secretion and trafficking lipoprotein releasing system, ATP-binding protein (TIGR02211; EC 3.6.3.-; HMM-score: 79.5)
    Metabolism Transport and binding proteins Anions nitrate ABC transporter, ATP-binding proteins C and D (TIGR01184; HMM-score: 79.1)
    Metabolism Transport and binding proteins Other nitrate ABC transporter, ATP-binding proteins C and D (TIGR01184; HMM-score: 79.1)
    Metabolism Transport and binding proteins Other thiamine ABC transporter, ATP-binding protein (TIGR01277; EC 3.6.3.-; HMM-score: 78.8)
    Metabolism Transport and binding proteins Amino acids, peptides and amines glycine betaine/L-proline transport ATP binding subunit (TIGR01186; HMM-score: 78.2)
    Cellular processes Cellular processes Biosynthesis of natural products NHLM bacteriocin system ABC transporter, peptidase/ATP-binding protein (TIGR03796; HMM-score: 77)
    Metabolism Transport and binding proteins Amino acids, peptides and amines NHLM bacteriocin system ABC transporter, peptidase/ATP-binding protein (TIGR03796; HMM-score: 77)
    thiol reductant ABC exporter, CydC subunit (TIGR02868; HMM-score: 75.4)
    Metabolism Transport and binding proteins Unknown substrate anchored repeat-type ABC transporter, ATP-binding subunit (TIGR03771; HMM-score: 74.4)
    Metabolism Transport and binding proteins Cations and iron carrying compounds nickel import ATP-binding protein NikE (TIGR02769; EC 3.6.3.24; HMM-score: 69.2)
    ectoine/hydroxyectoine ABC transporter, ATP-binding protein EhuA (TIGR03005; HMM-score: 68.9)
    phosphonate C-P lyase system protein PhnL (TIGR02324; HMM-score: 66.9)
    Cell structure Cell envelope Biosynthesis and degradation of surface polysaccharides and lipopolysaccharides lipid A export permease/ATP-binding protein MsbA (TIGR02203; HMM-score: 65.5)
    Metabolism Transport and binding proteins Other lipid A export permease/ATP-binding protein MsbA (TIGR02203; HMM-score: 65.5)
    Metabolism Biosynthesis of cofactors, prosthetic groups, and carriers Other FeS assembly ATPase SufC (TIGR01978; HMM-score: 63.1)
    Genetic information processing Protein fate Protein and peptide secretion and trafficking ABC-type bacteriocin transporter (TIGR01193; HMM-score: 62.9)
    Genetic information processing Protein fate Protein modification and repair ABC-type bacteriocin transporter (TIGR01193; HMM-score: 62.9)
    Metabolism Transport and binding proteins Other ABC-type bacteriocin transporter (TIGR01193; HMM-score: 62.9)
    Metabolism Transport and binding proteins Other antigen peptide transporter 2 (TIGR00958; HMM-score: 62.8)
    D-methionine ABC transporter, ATP-binding protein (TIGR02314; EC 3.6.3.-; HMM-score: 62.8)
    ABC transporter, permease/ATP-binding protein (TIGR02204; HMM-score: 62.2)
    Cellular processes Cellular processes Biosynthesis of natural products NHLM bacteriocin system ABC transporter, ATP-binding protein (TIGR03797; HMM-score: 59.6)
    Metabolism Transport and binding proteins Amino acids, peptides and amines NHLM bacteriocin system ABC transporter, ATP-binding protein (TIGR03797; HMM-score: 59.6)
    Genetic information processing Protein fate Protein and peptide secretion and trafficking type I secretion system ATPase (TIGR01846; HMM-score: 53.4)
    Metabolism Energy metabolism Methanogenesis methyl coenzyme M reductase system, component A2 (TIGR03269; HMM-score: 52.7)
    Metabolism Transport and binding proteins Cations and iron carrying compounds nickel import ATP-binding protein NikD (TIGR02770; HMM-score: 52.5)
    Metabolism Transport and binding proteins Other pleiotropic drug resistance family protein (TIGR00956; HMM-score: 49.3)
    Metabolism Central intermediary metabolism Phosphorus compounds phosphonate C-P lyase system protein PhnK (TIGR02323; HMM-score: 48.3)
    Metabolism Transport and binding proteins Amino acids, peptides and amines choline ABC transporter, ATP-binding protein (TIGR03415; HMM-score: 45.5)
    Metabolism Transport and binding proteins Anions cystic fibrosis transmembrane conductor regulator (CFTR) (TIGR01271; EC 3.6.3.49; HMM-score: 43.2)
    Metabolism Transport and binding proteins Carbohydrates, organic alcohols, and acids glucan exporter ATP-binding protein (TIGR01192; EC 3.6.3.42; HMM-score: 36.3)
    Metabolism Transport and binding proteins Other multi drug resistance-associated protein (MRP) (TIGR00957; HMM-score: 31.6)
    Genetic information processing DNA metabolism DNA replication, recombination, and repair excinuclease ABC subunit A (TIGR00630; EC 3.1.25.-; HMM-score: 30.9)
    Metabolism Transport and binding proteins Amino acids, peptides and amines cyclic peptide transporter (TIGR01194; HMM-score: 27.4)
    Metabolism Transport and binding proteins Other cyclic peptide transporter (TIGR01194; HMM-score: 27.4)
    Metabolism Transport and binding proteins Carbohydrates, organic alcohols, and acids peroxysomal long chain fatty acyl transporter (TIGR00954; HMM-score: 25.1)
    Genetic information processing DNA metabolism DNA replication, recombination, and repair DNA repair protein RecN (TIGR00634; HMM-score: 15.3)
    Genetic information processing DNA metabolism DNA replication, recombination, and repair DNA replication and repair protein RecF (TIGR00611; HMM-score: 13.3)
    Genetic information processing DNA metabolism Other MutS2 family protein (TIGR01069; HMM-score: 13)
    Unknown function General small GTP-binding protein domain (TIGR00231; HMM-score: 12.7)
    flagellar protein export ATPase FliI (TIGR03498; EC 3.6.3.14; HMM-score: 12.3)
    Cellular processes Cellular processes Chemotaxis and motility flagellar protein export ATPase FliI (TIGR03497; EC 3.6.3.14; HMM-score: 12)
    Cellular processes Cellular processes Chemotaxis and motility flagellar protein export ATPase FliI (TIGR03496; EC 3.6.3.14; HMM-score: 11.6)
    Metabolism Energy metabolism ATP-proton motive force interconversion ATPase, FliI/YscN family (TIGR01026; EC 3.6.3.14; HMM-score: 11.4)
    Genetic information processing Protein fate Protein and peptide secretion and trafficking type VII secretion protein EccCb (TIGR03925; HMM-score: 11.2)
  • TheSEED: see SA0266
  • PFAM:
    P-loop_NTPase (CL0023) ABC_tran; ABC transporter (PF00005; HMM-score: 113.7)
    and 25 more
    AAA_21; AAA domain, putative AbiEii toxin, Type IV TA system (PF13304; HMM-score: 49.8)
    AAA_23; AAA domain (PF13476; HMM-score: 31.4)
    AAA_29; P-loop containing region of AAA domain (PF13555; HMM-score: 23.8)
    RsgA_GTPase; RsgA GTPase (PF03193; HMM-score: 21.3)
    SMC_N; RecF/RecN/SMC N terminal domain (PF02463; HMM-score: 20.8)
    AAA_30; AAA domain (PF13604; HMM-score: 19.7)
    AAA_15; AAA ATPase domain (PF13175; HMM-score: 18.8)
    AAA_22; AAA domain (PF13401; HMM-score: 17.4)
    AAA_27; AAA domain (PF13514; HMM-score: 16.4)
    nSTAND3; Novel STAND NTPase 3 (PF20720; HMM-score: 16.4)
    AAA_13; AAA domain (PF13166; HMM-score: 15.9)
    AAA_16; AAA ATPase domain (PF13191; HMM-score: 15.4)
    DLIC; Dynein light intermediate chain (DLIC) (PF05783; HMM-score: 14.7)
    NACHT; NACHT domain (PF05729; HMM-score: 14.6)
    ORC-CDC6-like; ORC-CDC6-like (PF24389; HMM-score: 14.6)
    DUF5906; Family of unknown function (DUF5906) (PF19263; HMM-score: 14.2)
    VapE-like_dom; Virulence-associated protein E-like domain (PF05272; HMM-score: 14)
    MMR_HSR1; 50S ribosome-binding GTPase (PF01926; HMM-score: 13.9)
    G-alpha; G-protein alpha subunit (PF00503; HMM-score: 13.8)
    AAA; ATPase family associated with various cellular activities (AAA) (PF00004; HMM-score: 13.3)
    SbcC_Walker_B; SbcC/RAD50-like, Walker B motif (PF13558; HMM-score: 13.3)
    TsaE; Threonylcarbamoyl adenosine biosynthesis protein TsaE (PF02367; HMM-score: 13)
    NPHP3_N; Nephrocystin 3, N-terminal (PF24883; HMM-score: 12.9)
    nSTAND1; Novel STAND NTPase 1 (PF20703; HMM-score: 12.3)
    NB-ARC; NB-ARC domain (PF00931; HMM-score: 12.1)

Structure, modifications & cofactors[edit | edit source]

  • domains:
  • modifications:
  • cofactors:
  • effectors:

Localization[edit | edit source]

  • PSORTb: Cytoplasmic Membrane
    • Cytoplasmic Score: 1.05
    • Cytoplasmic Membrane Score: 8.78
    • Cellwall Score: 0.08
    • Extracellular Score: 0.09
    • Internal Helices: 0
  • DeepLocPro: Cytoplasmic
    • Cytoplasmic Score: 0.6136
    • Cytoplasmic Membrane Score: 0.3812
    • Cell wall & surface Score: 0.0007
    • Extracellular Score: 0.0045
  • LocateP:
  • SignalP: no predicted signal peptide
    • SP(Sec/SPI): 0.019845
    • TAT(Tat/SPI): 0.000411
    • LIPO(Sec/SPII): 0.000806
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit | edit source]

Protein sequence[edit | edit source]

  • MIEINNLSKRYRNKQIFNHLTMSFDSNRLTVLLGDNGAGKSTLLRMIAGIEKANDGTINYFGEKWNQRQIQNHIGYVPQDIALFEHMTVAENIKFFKSLCKNPINDTTINEYLQQLNFDDTSAKVSTLSGGNKRKINILVGLLGQPRILILDEPTVGIDLKSRHDIHQLLNIMKSKCLIILTTHHLDEVEALADDIKLIGQDPFYQHVLEDKQWAYTYY

Experimental data[edit | edit source]

  • experimentally validated: data available for NCTC8325
  • protein localization:
  • quantitative data / protein copy number per cell:
  • interaction partners:

Expression & Regulation[edit | edit source]

Operon[edit | edit source]

Regulation[edit | edit source]

  • regulator:

Transcription pattern[edit | edit source]

Protein synthesis (provided by Aureolib)[edit | edit source]

Protein stability[edit | edit source]

  • half-life: no data available

Biological Material[edit | edit source]

Mutants[edit | edit source]

Expression vector[edit | edit source]

lacZ fusion[edit | edit source]

GFP fusion[edit | edit source]

two-hybrid system[edit | edit source]

FLAG-tag construct[edit | edit source]

Antibody[edit | edit source]

Other Information[edit | edit source]

You are kindly invited to share additional interesting facts.

Literature[edit | edit source]

References[edit | edit source]

Relevant publications[edit | edit source]