From AureoWiki
Jump to navigation Jump to search

NCBI: 02-MAR-2017

Summary[edit | edit source]

  • organism: Staphylococcus aureus N315
  • locus tag: SA_RS01605 [old locus tag: SA0274 ]
  • pan locus tag?: SAUPAN001178000
  • symbol: SA_RS01605
  • pan gene symbol?: esaB
  • synonym:
  • product: type VII secretion protein EsaB

Additional information (user-provided)[edit | edit source]

Genome View[edit | edit source]

Gene[edit | edit source]

General[edit | edit source]

  • type: CDS
  • locus tag: SA_RS01605 [old locus tag: SA0274 ]
  • symbol: SA_RS01605
  • product: type VII secretion protein EsaB
  • replicon: chromosome
  • strand: +
  • coordinates: 330869..331150
  • length: 282
  • essential: no DEG other strains

Accession numbers[edit | edit source]

  • Location: NC_002745 (330869..331150) NCBI
  • BioCyc: SA_RS01605 BioCyc
  • MicrobesOnline: see SA0274

Phenotype[edit | edit source]

Additional information (user-provided)[edit | edit source]

DNA sequence[edit | edit source]

  • 1
    61
    121
    181
    241
    TTGTCATTTTTTCAATTCATAAAGGGAGACGAACGAAAAATGAATCAGCACGTAAAAGTA
    ACATTTGATTTTACTAATTATAATTACGGCACATATGACTTAGCAGTACCAGCATATTTA
    CCGATAAAAAATTTAATAGCTTTAGTATTGGATAGTTTGGACATTTCAATATTTGATGTC
    AATACACAAATTAAAGTGATGACGAAAGGTCAATTACTTGTTGAAAATGATCGACTCATT
    GATTATCAAATCGCTGATGGAGATATTTTGAAGTTACTATAG
    60
    120
    180
    240
    282


Protein[edit | edit source]

General[edit | edit source]

  • locus tag: SA_RS01605 [old locus tag: SA0274 ]
  • symbol: SA_RS01605
  • description: type VII secretion protein EsaB
  • length: 93
  • theoretical pI: 4.65437
  • theoretical MW: 10735.4
  • GRAVY: 0.0860215

Function[edit | edit source]

  • TIGRFAM:
  • TheSEED: see SA0274
  • PFAM:
    Ubiquitin (CL0072) YukD; WXG100 protein secretion system (Wss), protein YukD (PF08817; HMM-score: 45.3)
    and 4 more
    ubiquitin; Ubiquitin family (PF00240; HMM-score: 17.1)
    Rad60-SLD; Ubiquitin-2 like Rad60 SUMO-like (PF11976; HMM-score: 15.1)
    DMT (CL0184) Nuc_sug_transp; Nucleotide-sugar transporter (PF04142; HMM-score: 14.8)
    no clan defined DUF5488; Family of unknown function (DUF5488) (PF17590; HMM-score: 12.4)

Structure, modifications & cofactors[edit | edit source]

  • domains:
  • modifications:
  • cofactors:
  • effectors:

Localization[edit | edit source]

  • PSORTb: unknown (no significant prediction)
    • Cytoplasmic Score: 2.5
    • Cytoplasmic Membrane Score: 2.5
    • Cellwall Score: 2.5
    • Extracellular Score: 2.5
    • Internal Helices: 0
  • DeepLocPro: Cytoplasmic
    • Cytoplasmic Score: 0.9631
    • Cytoplasmic Membrane Score: 0.0221
    • Cell wall & surface Score: 0.0002
    • Extracellular Score: 0.0146
  • LocateP:
  • SignalP: no predicted signal peptide
    • SP(Sec/SPI): 0.003357
    • TAT(Tat/SPI): 0.00014
    • LIPO(Sec/SPII): 0.000289
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit | edit source]

Additional information (user-provided)[edit | edit source]

Protein sequence[edit | edit source]

  • MSFFQFIKGDERKMNQHVKVTFDFTNYNYGTYDLAVPAYLPIKNLIALVLDSLDISIFDVNTQIKVMTKGQLLVENDRLIDYQIADGDILKLL

Experimental data[edit | edit source]

  • experimentally validated: data available for COL
  • protein localization:
  • quantitative data / protein copy number per cell:
  • interaction partners:

Expression & Regulation[edit | edit source]

Operon[edit | edit source]

Regulation[edit | edit source]

  • regulator:

Additional information (user-provided)[edit | edit source]

Transcription pattern[edit | edit source]

Protein synthesis (provided by Aureolib)[edit | edit source]

Protein stability[edit | edit source]

  • half-life: no data available

Biological Material[edit | edit source]

Mutants[edit | edit source]

Expression vector[edit | edit source]

lacZ fusion[edit | edit source]

GFP fusion[edit | edit source]

two-hybrid system[edit | edit source]

FLAG-tag construct[edit | edit source]

Antibody[edit | edit source]

Additional information (user-provided)[edit | edit source]

Other information (user-provided)[edit | edit source]

You can add further information about the gene and protein here. [edit]

Literature[edit | edit source]

References[edit | edit source]


Relevant publications[edit | edit source]