From AureoWiki
Jump to navigation Jump to search

NCBI: 02-MAR-2017

Summary[edit | edit source]

  • organism: Staphylococcus aureus N315
  • locus tag: SA_RS02060 [old locus tag: SA0360 ]
  • pan locus tag?: SAUPAN001973000
  • symbol: SA_RS02060
  • pan gene symbol?:
  • synonym:
  • product: GlsB/YeaQ/YmgE family stress response membrane protein

Genome View[edit | edit source]

Gene[edit | edit source]

General[edit | edit source]

  • type: CDS
  • locus tag: SA_RS02060 [old locus tag: SA0360 ]
  • symbol: SA_RS02060
  • product: GlsB/YeaQ/YmgE family stress response membrane protein
  • replicon: chromosome
  • strand: +
  • coordinates: 417963..418214
  • length: 252
  • essential: no DEG other strains

Accession numbers[edit | edit source]

  • Location: NC_002745 (417963..418214) NCBI
  • BioCyc: SA_RS02060 BioCyc
  • MicrobesOnline: see SA0360

Phenotype[edit | edit source]

Share your knowledge and add information here. [edit]

DNA sequence[edit | edit source]

  • 1
    61
    121
    181
    241
    ATGTTTGGATTTATTGGAATGTTAATTGTCGGTGGCTTAATTGGATGGGCTGCTGGTGCT
    ATTATGGGTAAAGATATCCCAGGTGGTATTTTAGGCAATATTATCGCAGGTATTATTGGA
    TCATGGGTAGGTGGCAAACTATTCGGACAATGGGGTCCTGAATTAGGAAGTATTTACATC
    TTGCCAGCATTAATTGGTTCAATTATCTTAATTGCAATCGTAACGTTAATTTTAAGAGCT
    ATGCGTAAATAA
    60
    120
    180
    240
    252

Protein[edit | edit source]

General[edit | edit source]

  • locus tag: SA_RS02060 [old locus tag: SA0360 ]
  • symbol: SA_RS02060
  • description: GlsB/YeaQ/YmgE family stress response membrane protein
  • length: 83
  • theoretical pI: 10.6301
  • theoretical MW: 8533.45
  • GRAVY: 1.28193

Function[edit | edit source]

  • TIGRFAM:
    Genetic information processing Protein fate Protein and peptide secretion and trafficking proteobacterial sortase system peptidoglycan-associated protein (TIGR03789; HMM-score: 8.5)
  • TheSEED: see SA0360
  • PFAM:
    no clan defined Transgly_assoc; Transglycosylase associated protein (PF04226; HMM-score: 49.2)
    and 2 more
    DUF21; Domain of unknown function DUF21 (PF01595; HMM-score: 9)
    Glycine-zipper (CL0500) Gly-zipper_Omp; Glycine zipper (PF13488; HMM-score: 6.5)

Structure, modifications & cofactors[edit | edit source]

  • domains:
  • modifications:
  • cofactors:
  • effectors:

Localization[edit | edit source]

  • PSORTb: Cytoplasmic Membrane
    • Cytoplasmic Score: 0
    • Cytoplasmic Membrane Score: 10
    • Cellwall Score: 0
    • Extracellular Score: 0
    • Internal Helices: 3
  • LocateP:
  • SignalP: no predicted signal peptide
    • SP(Sec/SPI): 0.105843
    • TAT(Tat/SPI): 0.003344
    • LIPO(Sec/SPII): 0.138692
  • predicted transmembrane helices (TMHMM): 3

Accession numbers[edit | edit source]

Protein sequence[edit | edit source]

  • MFGFIGMLIVGGLIGWAAGAIMGKDIPGGILGNIIAGIIGSWVGGKLFGQWGPELGSIYILPALIGSIILIAIVTLILRAMRK

Experimental data[edit | edit source]

  • experimentally validated: data available for COL, NCTC8325
  • protein localization: data available for COL
  • quantitative data / protein copy number per cell:
  • interaction partners:

Expression & Regulation[edit | edit source]

Operon[edit | edit source]

Regulation[edit | edit source]

Transcription pattern[edit | edit source]

Protein synthesis (provided by Aureolib)[edit | edit source]

Protein stability[edit | edit source]

  • half-life: no data available

Biological Material[edit | edit source]

Mutants[edit | edit source]

Expression vector[edit | edit source]

lacZ fusion[edit | edit source]

GFP fusion[edit | edit source]

two-hybrid system[edit | edit source]

FLAG-tag construct[edit | edit source]

Antibody[edit | edit source]

Other Information[edit | edit source]

You are kindly invited to share additional interesting facts.

Literature[edit | edit source]

References[edit | edit source]

Relevant publications[edit | edit source]