Jump to navigation
Jump to search
COLN315NCTC8325NewmanUSA300_FPR3757JSNZ04-0298108BA0217611819-97685071193ECT-R 2ED133ED98HO 5096 0412JH1JH9JKD6008JKD6159LGA251M013MRSA252MSHR1132MSSA476MW2Mu3Mu50RF122ST398T0131TCH60TW20USA300_TCH1516VC40
NCBI: 02-MAR-2017
⊟Summary[edit | edit source]
- organism: Staphylococcus aureus N315
- locus tag: SA_RS06535
- pan locus tag?:
- symbol: SA_RS06535
- pan gene symbol?: —
- synonym:
- product: phage head morphogenesis protein
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: SA_RS06535
- symbol: SA_RS06535
- product: phage head morphogenesis protein
- replicon: chromosome
- strand: +
- coordinates: 1313065..1313301
- length: 237
- essential: unknown
⊟Accession numbers[edit | edit source]
⊟Phenotype[edit | edit source]
Share your knowledge and add information here. [edit]
⊟DNA sequence[edit | edit source]
- 1
61
121
181ATGCTTTTTTCATTATTCGTTGAAAAAGAAGAGTCACAAAAGTTAACATATTTAAAAGAA
CTTGGTGAAGATGACGAATATAAATATGTTGCCAAAATAGATAGTAAAACATCTAAATTA
TGTCATTCACTCAACGGAAAAATATTTATAGTTAAAGATATGATACCAGGTGTGAATGCG
CCACCTATGCATCCTTGGTGTAGAAGTACCACAGTGCCACATGTTGGCAATTGGTGA60
120
180
237
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: SA_RS06535
- symbol: SA_RS06535
- description: phage head morphogenesis protein
- length: 78
- theoretical pI: 7.50769
- theoretical MW: 8970.36
- GRAVY: -0.366667
⊟Function[edit | edit source]
- TIGRFAM: Mobile and extrachromosomal element functions Prophage functions phage head morphogenesis protein, SPP1 gp7 family (TIGR01641; HMM-score: 72.7)
- TheSEED:
- PFAM: no clan defined Phage_Mu_F; Phage Mu protein F like protein (PF04233; HMM-score: 44)
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
⊟Localization[edit | edit source]
- PSORTb: Cytoplasmic
- Cytoplasmic Score: 7.5
- Cytoplasmic Membrane Score: 1.15
- Cellwall Score: 0.62
- Extracellular Score: 0.73
- Internal Helices: 0
- DeepLocPro: Cytoplasmic
- Cytoplasmic Score: 0.5363
- Cytoplasmic Membrane Score: 0.0007
- Cell wall & surface Score: 0.0004
- Extracellular Score: 0.4626
- LocateP:
- SignalP: no predicted signal peptide
- SP(Sec/SPI): 0.012093
- TAT(Tat/SPI): 0.001692
- LIPO(Sec/SPII): 0.002366
- predicted transmembrane helices (TMHMM): 0
⊟Accession numbers[edit | edit source]
⊟Protein sequence[edit | edit source]
- MLFSLFVEKEESQKLTYLKELGEDDEYKYVAKIDSKTSKLCHSLNGKIFIVKDMIPGVNAPPMHPWCRSTTVPHVGNW
⊟Experimental data[edit | edit source]
- experimentally validated:
- protein localization:
- quantitative data / protein copy number per cell:
- interaction partners:
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
⊟Regulation[edit | edit source]
- regulator:
⊟Transcription pattern[edit | edit source]
- S.aureus Expression Data Browser: no data available
⊟Protein synthesis (provided by Aureolib)[edit | edit source]
- Aureolib: no data available
⊟Protein stability[edit | edit source]
- half-life: no data available
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Other Information[edit | edit source]
You can add further information about the gene and protein here. [edit]