From AureoWiki
Jump to navigation Jump to search

NCBI: 02-MAR-2017

Summary[edit | edit source]

  • organism: Staphylococcus aureus N315
  • locus tag: SA_RS07675 [old locus tag: SA1355 ]
  • pan locus tag?: SAUPAN004079000
  • symbol: SA_RS07675
  • pan gene symbol?: nusB
  • synonym:
  • product: N utilization substance protein B

Genome View[edit | edit source]

Gene[edit | edit source]

General[edit | edit source]

  • type: CDS
  • locus tag: SA_RS07675 [old locus tag: SA1355 ]
  • symbol: SA_RS07675
  • product: N utilization substance protein B
  • replicon: chromosome
  • strand: -
  • coordinates: 1565385..1565774
  • length: 390
  • essential: unknown

Accession numbers[edit | edit source]

  • Location: NC_002745 (1565385..1565774) NCBI
  • BioCyc: G1G21-1544 BioCyc
  • MicrobesOnline:

Phenotype[edit | edit source]

Share your knowledge and add information here. [edit]

DNA sequence[edit | edit source]

  • 1
    61
    121
    181
    241
    301
    361
    ATGAGTCGTAAAGAATCCCGAGTGCAAGCTTTTCAAACTTTATTTCAATTAGAAATGAAG
    GACAGTGATTTAACGATAAATGAAGCGATAAGTTTTATTAAAGACGATAATCCAGATTTA
    GACTTTGAATTTATTCATTGGCTAGTTTCTGGCGTTAAAGATCACGAACCTGTATTAGAC
    GAGACAATTAGTCCTTATTTAAAAGATTGGACTATTGCACGTTTATTAAAAACGGATCGT
    ATTATTTTAAGAATGGCAACATATGAAATATTACACAGTGATACACCTGCTAAAGTCGTA
    ATGAATGAAGCAGTTGAATTAACAAAACAATTCAGTGATGATGATCATTATAAATTTATA
    AATGGTGTATTGAGTAATATAAAAAAATAA
    60
    120
    180
    240
    300
    360
    390

Protein[edit | edit source]

General[edit | edit source]

  • locus tag: SA_RS07675 [old locus tag: SA1355 ]
  • symbol: SA_RS07675
  • description: N utilization substance protein B
  • length: 129
  • theoretical pI: 4.80681
  • theoretical MW: 15061.1
  • GRAVY: -0.351938

Function[edit | edit source]

  • TIGRFAM:
    Genetic information processing Transcription Transcription factors transcription antitermination factor NusB (TIGR01951; HMM-score: 135.8)
    and 1 more
    Genetic information processing Protein synthesis tRNA and rRNA base modification 16S rRNA (cytosine(967)-C(5))-methyltransferase (TIGR00563; EC 2.1.1.176; HMM-score: 27.7)
  • TheSEED:
  • PFAM:
    NusB (CL0633) NusB; NusB family (PF01029; HMM-score: 118.6)

Structure, modifications & interactions[edit | edit source]

  • domains:
  • modifications:
  • cofactors:
  • effectors:
  • protein partners:

Localization[edit | edit source]

  • PSORTb: unknown (no significant prediction)
    • Cytoplasmic Score: 2.5
    • Cytoplasmic Membrane Score: 2.5
    • Cellwall Score: 2.5
    • Extracellular Score: 2.5
    • Internal Helices: 0
  • LocateP:
  • SignalP: no predicted signal peptide
    • SP(Sec/SPI): 0.002999
    • TAT(Tat/SPI): 0.000255
    • LIPO(Sec/SPII): 0.000267
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit | edit source]

  • GI: 446009530 NCBI
  • RefSeq: WP_000087385 NCBI
  • UniProt:

Protein sequence[edit | edit source]

  • MSRKESRVQAFQTLFQLEMKDSDLTINEAISFIKDDNPDLDFEFIHWLVSGVKDHEPVLDETISPYLKDWTIARLLKTDRIILRMATYEILHSDTPAKVVMNEAVELTKQFSDDDHYKFINGVLSNIKK

Experimental data[edit | edit source]

  • experimentally validated: no data available

Expression & Regulation[edit | edit source]

Operon[edit | edit source]

Regulation[edit | edit source]

  • regulator:

Transcription pattern[edit | edit source]

Protein synthesis (provided by Aureolib)[edit | edit source]

Protein stability[edit | edit source]

  • half-life: no data available

Biological Material[edit | edit source]

Mutants[edit | edit source]

Expression vector[edit | edit source]

lacZ fusion[edit | edit source]

GFP fusion[edit | edit source]

two-hybrid system[edit | edit source]

FLAG-tag construct[edit | edit source]

Antibody[edit | edit source]

Other Information[edit | edit source]

You are kindly invited to share additional interesting facts.

Literature[edit | edit source]

References[edit | edit source]

Relevant publications[edit | edit source]