Jump to navigation
Jump to search
NCBI: 02-MAR-2017
⊟Summary[edit | edit source]
- organism: Staphylococcus aureus N315
- locus tag: SA_RS08065 [old locus tag: SA1429 ]
- pan locus tag?: SAUPAN004189000
- symbol: SA_RS08065
- pan gene symbol?: —
- synonym:
- product: carboxylate--amine ligase
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
⊟Accession numbers[edit | edit source]
⊟Phenotype[edit | edit source]
Share your knowledge and add information here. [edit]
⊟DNA sequence[edit | edit source]
- 1
61
121
181ATTCAAGAATTAGATGTTCAATTAAGAAATTATTTGAATGAGAAGTATAAGTTGTACGAA
CAAGGTGGCGACATTGTTAAAGGGTATGTTAAATATCATAATGATGATGAACAAAATGTA
GAATATGATTTTTATAATTTAAATGGTGAGTATGGTTATGAGGTATTAAAAATGTATGCT
GATAATAAAACTATCAATAGAGACAAATTGCATTTAGATATCTATTTATTCAAATCATAA60
120
180
240
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: SA_RS08065 [old locus tag: SA1429 ]
- symbol: SA_RS08065
- description: carboxylate--amine ligase
- length: 79
- theoretical pI: 4.61375
- theoretical MW: 9629.63
- GRAVY: -1
⊟Function[edit | edit source]
- TIGRFAM:
- TheSEED: see SA1429
- PFAM: Ubiquitin (CL0072) Stap_Strp_tox_C; Staphylococcal/Streptococcal toxin, beta-grasp domain (PF02876; HMM-score: 62.5)and 1 moreArrestin_N-like (CL0135) Bul1_N; Bul1 N terminus (PF04425; HMM-score: 13.3)
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
⊟Localization[edit | edit source]
- PSORTb: Extracellular
- Cytoplasmic Score: 0.01
- Cytoplasmic Membrane Score: 0.09
- Cellwall Score: 0.18
- Extracellular Score: 9.72
- Internal Helices: 0
- DeepLocPro: Extracellular
- Cytoplasmic Score: 0.4397
- Cytoplasmic Membrane Score: 0.0128
- Cell wall & surface Score: 0.0001
- Extracellular Score: 0.5474
- LocateP:
- SignalP: no predicted signal peptide
- SP(Sec/SPI): 0.041668
- TAT(Tat/SPI): 0.000403
- LIPO(Sec/SPII): 0.003014
- predicted transmembrane helices (TMHMM): 0
⊟Protein sequence[edit | edit source]
- MQELDVQLRNYLNEKYKLYEQGGDIVKGYVKYHNDDEQNVEYDFYNLNGEYGYEVLKMYADNKTINRDKLHLDIYLFKS
⊟Experimental data[edit | edit source]
- experimentally validated:
- protein localization:
- quantitative data / protein copy number per cell:
- interaction partners:
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
⊟Regulation[edit | edit source]
- regulator:
⊟Transcription pattern[edit | edit source]
- S.aureus Expression Data Browser: no data available
⊟Protein synthesis (provided by Aureolib)[edit | edit source]
- Aureolib: no data available
⊟Protein stability[edit | edit source]
- half-life: no data available
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Other Information[edit | edit source]
You can add further information about the gene and protein here. [edit]