From AureoWiki
Jump to navigation Jump to search
COLN315NCTC8325NewmanUSA300_FPR375704-0298108BA0217611819-97685071193ECT-R 2ED133ED98HO 5096 0412JH1JH9JKD6008JKD6159LGA251M013MRSA252MSHR1132MSSA476MW2Mu3Mu50RF122ST398T0131TCH60TW20USA300_TCH1516VC40

NCBI: 02-MAR-2017

Summary[edit | edit source]

  • organism: Staphylococcus aureus N315
  • locus tag: SA_RS10080
  • pan locus tag?:
  • symbol: SA_RS10080
  • pan gene symbol?:
  • synonym:
  • product: hypothetical protein

Genome View[edit | edit source]

Gene[edit | edit source]

General[edit | edit source]

  • type: CDS
  • locus tag: SA_RS10080
  • symbol: SA_RS10080
  • product: hypothetical protein
  • replicon: chromosome
  • strand: +
  • coordinates: 2006215..2006475
  • length: 261
  • essential: unknown

Accession numbers[edit | edit source]

  • Location: NC_002745 (2006215..2006475) NCBI
  • BioCyc: G1G21-2033 BioCyc
  • MicrobesOnline:

Phenotype[edit | edit source]

Share your knowledge and add information here. [edit]

DNA sequence[edit | edit source]

  • 1
    61
    121
    181
    241
    GTGTGTATTGTTATTTACCTAATTTATAGTCTAATTGTCTATTTCATCTGCATTATAAAT
    TTTTTCATAATGGCTGCACCATTCTTAATGACTAATGCTGATTATGTATGGACGCCTATG
    ACTACAGTTACGTTATTTATTTTGAGTTTGATTATTTTCTTGATATTTATAAAAACAAAA
    GATGTCGTTCATTTAACAATTTTCATATTAAACTTACTTTTTTCAATACTTTATTGTTTG
    CCTATACTGTTTTATTTATGA
    60
    120
    180
    240
    261

Protein[edit | edit source]

General[edit | edit source]

  • locus tag: SA_RS10080
  • symbol: SA_RS10080
  • description: hypothetical protein
  • length: 86
  • theoretical pI: 7.17012
  • theoretical MW: 10144.6
  • GRAVY: 1.83605

Function[edit | edit source]

  • TIGRFAM:
  • TheSEED:
  • PFAM:

Structure, modifications & interactions[edit | edit source]

  • domains:
  • modifications:
  • cofactors:
  • effectors:
  • protein partners:

Localization[edit | edit source]

  • PSORTb: Cytoplasmic Membrane
    • Cytoplasmic Score: 0
    • Cytoplasmic Membrane Score: 10
    • Cellwall Score: 0
    • Extracellular Score: 0
    • Internal Helices: 3
  • LocateP:
  • SignalP: no predicted signal peptide
    • SP(Sec/SPI): 0.009059
    • TAT(Tat/SPI): 0.000402
    • LIPO(Sec/SPII): 0.025246
  • predicted transmembrane helices (TMHMM): 3

Accession numbers[edit | edit source]

  • GI:
  • RefSeq: WP_001791826 NCBI
  • UniProt:

Protein sequence[edit | edit source]

  • MCIVIYLIYSLIVYFICIINFFIMAAPFLMTNADYVWTPMTTVTLFILSLIIFLIFIKTKDVVHLTIFILNLLFSILYCLPILFYL

Experimental data[edit | edit source]

  • experimentally validated: no data available

Expression & Regulation[edit | edit source]

Operon[edit | edit source]

Regulation[edit | edit source]

  • regulator:

Transcription pattern[edit | edit source]

Protein synthesis (provided by Aureolib)[edit | edit source]

Protein stability[edit | edit source]

  • half-life: no data available

Biological Material[edit | edit source]

Mutants[edit | edit source]

Expression vector[edit | edit source]

lacZ fusion[edit | edit source]

GFP fusion[edit | edit source]

two-hybrid system[edit | edit source]

FLAG-tag construct[edit | edit source]

Antibody[edit | edit source]

Other Information[edit | edit source]

You are kindly invited to share additional interesting facts.

Literature[edit | edit source]

References[edit | edit source]

Relevant publications[edit | edit source]