From AureoWiki
Jump to: navigation, search
Pangenome04-0298108BA0217611819-97685071193COLECT-R 2ED133ED98HO 5096 0412JH1JH9JKD6008JKD6159LGA251M013MRSA252MSHR1132MSSA476MW2Mu3Mu50N315NCTC8325NewmanRF122ST398T0131TCH60TW20USA300_FPR3757USA300_TCH1516VC40

NCBI: 02-MAR-2017

Summary[edit source | edit]

  • organism: Staphylococcus aureus N315
  • locus tag: SA_RS13050 [old locus tag: SA2273 ]
  • pan locus tag?: SAUPAN006072000
  • symbol: SA_RS13050
  • pan gene symbol?:
  • synonym:
  • product: tandem-type lipoprotein

Genome View[edit source | edit]

Gene[edit source | edit]

General[edit source | edit]

  • type: CDS
  • locus tag: SA_RS13050 [old locus tag: SA2273 ]
  • symbol: SA_RS13050
  • product: tandem-type lipoprotein
  • replicon: chromosome
  • strand: -
  • coordinates: 2548605..2549399
  • length: 795
  • essential: unknown

Accession numbers[edit source | edit]

  • Location: NC_002745 (2548605..2549399) NCBI
  • BioCyc: G1G21-2650 BioCyc
  • MicrobesOnline:

Phenotype[edit source | edit]

Share your knowledge and add information here. [edit]

DNA sequence[edit source | edit]

  • 1
    61
    121
    181
    241
    301
    361
    421
    481
    541
    601
    661
    721
    781
    ATGATTCATTCAAAAAAATTAACGCTCGGTATATGTTTGGTATTACTCATTATATTGATT
    GGAGGTTGTATCATTATGACAAAAATAAATAGTCGAAATGCCCAAATTAAAGACACATTT
    AATCAAACATTAAATGTGTATCCAACCAAGAATCTTGATGATTTTTACGATAAGGAAGGC
    TTTCGAGATCAAGAATTTGATAAAAGAGATAAAGGGACTTGGATTATTAATTCTGGAATG
    TACATCCAATTAAAAGGAGGAGCCTTAAAATCCAGAGCGATGGTACTTTACATCAATCGT
    AACACTAGAACAGCTAAGGGATATTTTTTAATAAGTGAGACAACAGAAGACAAAAAAGGA
    TACGTTCATAATAAAGATAAAAAATACCCTGTCAAGATGGAACGTAATCGAATAATTCCA
    ACGAAGCCCATAACGGACGAGAAGTTAAAAAAAGAGATTGAAAACTTTAAGTTCTTTGTA
    CAATATGGGAATTTTAAAGATTTTAAAGATTATAAAGATGGGGATATTTCATACAATCCT
    AACGTACCAAGTTATTCCGCAAAGTATCAATTGAATAATGATGATTATAATGTCCAACAA
    TTAAGAAAACGATATGATATATCAACCAAAAGGGCACCTGAATTAAAATTGAGAGGATCT
    GGCGATTTAAAAGGCTCATCCGTAGGTTCTAAAGAACTAGAATTTAACTTTGTAAGAAAT
    AAAGAGGAAAATGTGTATTTTTCTGATGGTATTAATTTCAAACCTACTGAGGAAATGAAT
    CATGAACAAAACTAA
    60
    120
    180
    240
    300
    360
    420
    480
    540
    600
    660
    720
    780
    795

Protein[edit source | edit]

General[edit source | edit]

  • locus tag: SA_RS13050 [old locus tag: SA2273 ]
  • symbol: SA_RS13050
  • description: tandem-type lipoprotein
  • length: 264
  • theoretical pI: 9.80846
  • theoretical MW: 30831.9
  • GRAVY: -0.806818

Function[edit source | edit]

  • TIGRFAM:
    Staphylococcus tandem lipoproteins (TIGR01742; HMM-score: 336)
  • TheSEED:
  • PFAM:
    LolA_LolB (CL0048) DUF576; Csa1 family (PF04507; HMM-score: 419.7)

Structure, modifications & interactions[edit source | edit]

  • domains:
  • modifications:
  • cofactors:
  • effectors:
  • protein partners:

Localization[edit source | edit]

  • PSORTb: Cytoplasmic Membrane
    • Cytoplasmic Score: 0.32
    • Cytoplasmic Membrane Score: 9.55
    • Cellwall Score: 0.12
    • Extracellular Score: 0.01
    • Internal Helix: 1
  • LocateP:
  • SignalP: Signal peptide LIPO(Sec/SPII) length 22 aa
    • SP(Sec/SPI): 0.012482
    • TAT(Tat/SPI): 0.000086
    • LIPO(Sec/SPII): 0.986085
    • Cleavage Site: CS pos: 22-23. IGG-CI. Pr: 0.9867
  • predicted transmembrane helices (TMHMM): 1

Accession numbers[edit source | edit]

  • GI:
  • RefSeq: WP_000581871 NCBI
  • UniProt:

Protein sequence[edit source | edit]

  • MIHSKKLTLGICLVLLIILIGGCIIMTKINSRNAQIKDTFNQTLNVYPTKNLDDFYDKEGFRDQEFDKRDKGTWIINSGMYIQLKGGALKSRAMVLYINRNTRTAKGYFLISETTEDKKGYVHNKDKKYPVKMERNRIIPTKPITDEKLKKEIENFKFFVQYGNFKDFKDYKDGDISYNPNVPSYSAKYQLNNDDYNVQQLRKRYDISTKRAPELKLRGSGDLKGSSVGSKELEFNFVRNKEENVYFSDGINFKPTEEMNHEQN

Experimental data[edit source | edit]

  • experimentally validated: no data available

Expression & Regulation[edit source | edit]

Operon[edit source | edit]

Regulation[edit source | edit]

  • regulator:

Transcription pattern[edit source | edit]

Protein synthesis (provided by Aureolib)[edit source | edit]

Protein stability[edit source | edit]

  • half-life: no data available

Biological Material[edit source | edit]

Mutants[edit source | edit]

Expression vector[edit source | edit]

lacZ fusion[edit source | edit]

GFP fusion[edit source | edit]

two-hybrid system[edit source | edit]

FLAG-tag construct[edit source | edit]

Antibody[edit source | edit]

Other Information[edit source | edit]

You are kindly invited to share additional interesting facts.

Literature[edit source | edit]

References[edit source | edit]

Relevant publications[edit source | edit]