From AureoWiki
Jump to navigation Jump to search

NCBI: 02-MAR-2017

Summary[edit | edit source]

  • organism: Staphylococcus aureus N315
  • locus tag: SA_RS13360 [old locus tag: SA2331 ]
  • pan locus tag?: SAUPAN006200000
  • symbol: SA_RS13360
  • pan gene symbol?:
  • synonym:
  • product: hypothetical protein

Additional information (user-provided)[edit | edit source]

Genome View[edit | edit source]

Gene[edit | edit source]

General[edit | edit source]

  • type: CDS
  • locus tag: SA_RS13360 [old locus tag: SA2331 ]
  • symbol: SA_RS13360
  • product: hypothetical protein
  • replicon: chromosome
  • strand: +
  • coordinates: 2616044..2616262
  • length: 219
  • essential: no DEG other strains

Accession numbers[edit | edit source]

  • Location: NC_002745 (2616044..2616262) NCBI
  • BioCyc: SA_RS13360 BioCyc
  • MicrobesOnline: see SA2331

Phenotype[edit | edit source]

Additional information (user-provided)[edit | edit source]

DNA sequence[edit | edit source]

  • 1
    61
    121
    181
    TTGAGCTTTTACGAATTTATGCAAAGTTTTCTTGGTGATGACACACCATTAGGTGAATTG
    GTTGATTGGATTAATCAAGATAGCAATTTCCCTAGAGAAGTGAAGAGCCATAGTGAAATA
    TTGTCATATTTTCGAACAAATCCATGTCCTGAAAGCATCTCAGTACCTGTAATTAAACGG
    GCACTATCAGTTTTCAACCAATTCACAAATGTACAATGA
    60
    120
    180
    219


Protein[edit | edit source]

General[edit | edit source]

  • locus tag: SA_RS13360 [old locus tag: SA2331 ]
  • symbol: SA_RS13360
  • description: hypothetical protein
  • length: 72
  • theoretical pI: 4.34809
  • theoretical MW: 8348.33
  • GRAVY: -0.266667

Function[edit | edit source]

  • TIGRFAM:
  • TheSEED: see SA2331
  • PFAM:
    no clan defined YozE_SAM_like; YozE SAM-like fold (PF06855; HMM-score: 67.5)
    and 1 more
    DUF1885; Domain of unknown function (DUF1885) (PF08968; HMM-score: 12)

Structure, modifications & cofactors[edit | edit source]

  • domains:
  • modifications:
  • cofactors:
  • effectors:

Localization[edit | edit source]

  • PSORTb: unknown (no significant prediction)
    • Cytoplasmic Score: 2.5
    • Cytoplasmic Membrane Score: 2.5
    • Cellwall Score: 2.5
    • Extracellular Score: 2.5
    • Internal Helices: 0
  • DeepLocPro: Cytoplasmic
    • Cytoplasmic Score: 0.4554
    • Cytoplasmic Membrane Score: 0.4125
    • Cell wall & surface Score: 0.0001
    • Extracellular Score: 0.1321
  • LocateP:
  • SignalP: no predicted signal peptide
    • SP(Sec/SPI): 0.005104
    • TAT(Tat/SPI): 0.000649
    • LIPO(Sec/SPII): 0.000932
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit | edit source]

Additional information (user-provided)[edit | edit source]

Protein sequence[edit | edit source]

  • MSFYEFMQSFLGDDTPLGELVDWINQDSNFPREVKSHSEILSYFRTNPCPESISVPVIKRALSVFNQFTNVQ

Experimental data[edit | edit source]

  • experimentally validated:
  • protein localization:
  • quantitative data / protein copy number per cell:
  • interaction partners:

Expression & Regulation[edit | edit source]

Operon[edit | edit source]

Regulation[edit | edit source]

  • regulator:

Additional information (user-provided)[edit | edit source]

Transcription pattern[edit | edit source]

Protein synthesis (provided by Aureolib)[edit | edit source]

Protein stability[edit | edit source]

  • half-life: no data available

Biological Material[edit | edit source]

Mutants[edit | edit source]

Expression vector[edit | edit source]

lacZ fusion[edit | edit source]

GFP fusion[edit | edit source]

two-hybrid system[edit | edit source]

FLAG-tag construct[edit | edit source]

Antibody[edit | edit source]

Additional information (user-provided)[edit | edit source]

Other information (user-provided)[edit | edit source]

You can add further information about the gene and protein here. [edit]

Literature[edit | edit source]

References[edit | edit source]


Relevant publications[edit | edit source]