From AureoWiki
Jump to navigation Jump to search

NCBI: 02-MAR-2017

Summary[edit | edit source]

  • organism: Staphylococcus aureus N315
  • locus tag: SA_RS13390 [old locus tag: SAS088 ]
  • pan locus tag?: SAUPAN006211000
  • symbol: SA_RS13390
  • pan gene symbol?:
  • synonym:
  • product: FeoB-associated Cys-rich membrane protein

Genome View[edit | edit source]

Gene[edit | edit source]

General[edit | edit source]

  • type: CDS
  • locus tag: SA_RS13390 [old locus tag: SAS088 ]
  • symbol: SA_RS13390
  • product: FeoB-associated Cys-rich membrane protein
  • replicon: chromosome
  • strand: -
  • coordinates: 2623189..2623359
  • length: 171
  • essential: no DEG other strains

Accession numbers[edit | edit source]

  • Location: NC_002745 (2623189..2623359) NCBI
  • BioCyc: G1G21-2719 BioCyc
  • MicrobesOnline:

Phenotype[edit | edit source]

Share your knowledge and add information here. [edit]

DNA sequence[edit | edit source]

  • 1
    61
    121
    GTGTCAGTCATTATTAACATTTTAATTTTTTTAGCAATTTTCGGATATGCCTTATATACA
    CTAGTAAAATTTTTCAAGCGTTCGAAACAAGGAAAATGTGGTACATGTGACATTAATCGT
    GATTGTTGTGGAATAGAACAGCACACAGCGAATCATTTTCCAGGGAAATAA
    60
    120
    171

Protein[edit | edit source]

General[edit | edit source]

  • locus tag: SA_RS13390 [old locus tag: SAS088 ]
  • symbol: SA_RS13390
  • description: FeoB-associated Cys-rich membrane protein
  • length: 56
  • theoretical pI: 9.0099
  • theoretical MW: 6325.47
  • GRAVY: 0.242857

Function[edit | edit source]

  • TIGRFAM:
    Genetic information processing DNA metabolism DNA replication, recombination, and repair A/G-specific adenine glycosylase (TIGR01084; EC 3.2.2.-; HMM-score: 13.1)
  • TheSEED: see SAS088
  • PFAM:
    no clan defined P12; Virus attachment protein p12 family (PF12669; HMM-score: 36.3)
    and 1 more
    DUF2569; Protein of unknown function (DUF2569) (PF10754; HMM-score: 14.8)

Structure, modifications & cofactors[edit | edit source]

  • domains:
  • modifications:
  • cofactors:
  • effectors:

Localization[edit | edit source]

  • PSORTb: unknown (no significant prediction)
    • Cytoplasmic Score: 2.5
    • Cytoplasmic Membrane Score: 2.5
    • Cellwall Score: 2.5
    • Extracellular Score: 2.5
    • Internal Helix: 1
  • LocateP:
  • SignalP: no predicted signal peptide
    • SP(Sec/SPI): 0.379507
    • TAT(Tat/SPI): 0.013845
    • LIPO(Sec/SPII): 0.031988
  • predicted transmembrane helices (TMHMM): 1

Accession numbers[edit | edit source]

  • GI: 446033262 NCBI
  • RefSeq: WP_000111117 NCBI
  • UniProt:

Protein sequence[edit | edit source]

  • MSVIINILIFLAIFGYALYTLVKFFKRSKQGKCGTCDINRDCCGIEQHTANHFPGK

Experimental data[edit | edit source]

  • experimentally validated:
  • protein localization:
  • quantitative data / protein copy number per cell:
  • interaction partners:

Expression & Regulation[edit | edit source]

Operon[edit | edit source]

Regulation[edit | edit source]

  • regulator:

Transcription pattern[edit | edit source]

Protein synthesis (provided by Aureolib)[edit | edit source]

Protein stability[edit | edit source]

  • half-life: no data available

Biological Material[edit | edit source]

Mutants[edit | edit source]

Expression vector[edit | edit source]

lacZ fusion[edit | edit source]

GFP fusion[edit | edit source]

two-hybrid system[edit | edit source]

FLAG-tag construct[edit | edit source]

Antibody[edit | edit source]

Other Information[edit | edit source]

You are kindly invited to share additional interesting facts.

Literature[edit | edit source]

References[edit | edit source]

Relevant publications[edit | edit source]