Jump to navigation
Jump to search
NCBI: 02-MAR-2017
⊟Summary[edit | edit source]
- organism: Staphylococcus aureus N315
- locus tag: SA_RS13580 [old locus tag: SA2371 ]
- pan locus tag?: SAUPAN006264000
- symbol: SA_RS13580
- pan gene symbol?: —
- synonym:
- product: type II secretion protein
⊟Additional information (user-provided)[edit | edit source]
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: SA_RS13580 [old locus tag: SA2371 ]
- symbol: SA_RS13580
- product: type II secretion protein
- replicon: chromosome
- strand: -
- coordinates: 2661703..2661999
- length: 297
- essential: no DEG other strains
⊟Accession numbers[edit | edit source]
⊟Phenotype[edit | edit source]
⊟Additional information (user-provided)[edit | edit source]
⊟DNA sequence[edit | edit source]
- 1
61
121
181
241ATGGAAACAATAGGAAGCATTATTTATTTAAAAGAAGGTTCGCAAAAGTTAATGATTATT
AATAGAGGACCAATTGTAGAAATTGAAAATCAAAAGTATATGTTTGACTATTCTGCATGT
AAATATCCGATTGGTGTTGTGGAAGATGAAATTTATTATTTTAACGAAGAAAATATAGAT
TCAGTTATTTTTAAAGGTTATTCTGATCAAGATGAGGTTAGATTTCAAGAGTTGTTTGAA
AATATGAAACAAAATTTGGATAGTGAAATACAACGTGGAGAAGTTACACCACAATAA60
120
180
240
297
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: SA_RS13580 [old locus tag: SA2371 ]
- symbol: SA_RS13580
- description: type II secretion protein
- length: 98
- theoretical pI: 4.01648
- theoretical MW: 11546.9
- GRAVY: -0.521429
⊟Function[edit | edit source]
- TIGRFAM: mobile rSAM pair MarR family regulator (TIGR04472; HMM-score: 14.3)
- TheSEED: see SA2371
- PFAM: no clan defined DUF4176; Domain of unknown function (DUF4176) (PF13780; HMM-score: 91.8)and 3 moreUBA (CL0214) HBS1_N; HBS1 N-terminus (PF08938; HMM-score: 17.2)no clan defined DUF6843; Family of unknown function (DUF6843) (PF20862; HMM-score: 15.2)ZnExoPePases (CL0865) DUF4910; Domain of unknown function (DUF4910) (PF16254; HMM-score: 11.4)
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
⊟Localization[edit | edit source]
- PSORTb: Cytoplasmic
- Cytoplasmic Score: 7.5
- Cytoplasmic Membrane Score: 1.15
- Cellwall Score: 0.62
- Extracellular Score: 0.73
- Internal Helices: 0
- DeepLocPro: Cytoplasmic
- Cytoplasmic Score: 0.9699
- Cytoplasmic Membrane Score: 0.0167
- Cell wall & surface Score: 0.0002
- Extracellular Score: 0.0132
- LocateP:
- SignalP: no predicted signal peptide
- SP(Sec/SPI): 0.006296
- TAT(Tat/SPI): 0.000112
- LIPO(Sec/SPII): 0.001784
- predicted transmembrane helices (TMHMM): 0
⊟Accession numbers[edit | edit source]
⊟Additional information (user-provided)[edit | edit source]
⊟Protein sequence[edit | edit source]
- METIGSIIYLKEGSQKLMIINRGPIVEIENQKYMFDYSACKYPIGVVEDEIYYFNEENIDSVIFKGYSDQDEVRFQELFENMKQNLDSEIQRGEVTPQ
⊟Experimental data[edit | edit source]
- experimentally validated: data available for COL, NCTC8325
- protein localization: data available for COL
- quantitative data / protein copy number per cell: data available for COL
- interaction partners:
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
⊟Regulation[edit | edit source]
- regulator:
⊟Additional information (user-provided)[edit | edit source]
⊟Transcription pattern[edit | edit source]
- S.aureus Expression Data Browser: data available for NCTC8325
⊟Protein synthesis (provided by Aureolib)[edit | edit source]
- Aureolib: no data available
⊟Protein stability[edit | edit source]
- half-life: no data available
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Additional information (user-provided)[edit | edit source]
⊟Other information (user-provided)[edit | edit source]
You can add further information about the gene and protein here. [edit]
⊟Literature[edit | edit source]
⊟References[edit | edit source]