From AureoWiki
Jump to navigation Jump to search
COLN315NCTC8325NewmanUSA300_FPR375704-0298108BA0217611819-97685071193ECT-R 2ED133ED98HO 5096 0412JH1JH9JKD6008JKD6159LGA251M013MRSA252MSHR1132MSSA476MW2Mu3Mu50RF122ST398T0131TCH60TW20USA300_TCH1516VC40

NCBI: 02-MAR-2017

Summary[edit | edit source]

  • organism: Staphylococcus aureus N315
  • locus tag: SA_RS14515
  • pan locus tag?:
  • symbol: SA_RS14515
  • pan gene symbol?:
  • synonym:
  • product: 50S ribosomal protein L33

Genome View[edit | edit source]

Gene[edit | edit source]

General[edit | edit source]

  • type: CDS
  • locus tag: SA_RS14515
  • symbol: SA_RS14515
  • product: 50S ribosomal protein L33
  • replicon: chromosome
  • strand: +
  • coordinates: 574994..575137
  • length: 144
  • essential: unknown

Accession numbers[edit | edit source]

  • Location: NC_002745 (574994..575137) NCBI
  • BioCyc: SA_RS14515 BioCyc
  • MicrobesOnline:

Phenotype[edit | edit source]

Share your knowledge and add information here. [edit]

DNA sequence[edit | edit source]

  • 1
    61
    121
    GTGAGAAAAATACCTTTAAATTGTGAAGCTTGTGGCAATAGAAATTATAATGTTCCTAAG
    CAAGAAGGCTCGGCAACAAGATTAACCTTAAAGAAATATTGTCCAAAATGTAACGCGCAC
    ACAATTCATAAAGAATCGAAATAA
    60
    120
    144

Protein[edit | edit source]

General[edit | edit source]

  • locus tag: SA_RS14515
  • symbol: SA_RS14515
  • description: 50S ribosomal protein L33
  • length: 47
  • theoretical pI: 10.0872
  • theoretical MW: 5375.25
  • GRAVY: -1.03617

Function[edit | edit source]

  • TIGRFAM:
    Genetic information processing Protein synthesis Ribosomal proteins: synthesis and modification ribosomal protein bL33 (TIGR01023; HMM-score: 51.7)
  • TheSEED:
  • PFAM:
    Zn_Beta_Ribbon (CL0167) Ribosomal_L33; Ribosomal protein L33 (PF00471; HMM-score: 60)
    and 14 more
    NOB1_Zn_bind; Nin one binding (NOB1) Zn-ribbon like (PF08772; HMM-score: 17.6)
    DZR; Double zinc ribbon (PF12773; HMM-score: 16.1)
    Ribosomal_L37e; Ribosomal protein L37e (PF01907; HMM-score: 15.6)
    Zn-ribbon_8; Zinc ribbon domain (PF09723; HMM-score: 15.2)
    no clan defined Nop10p; Nucleolar RNA-binding protein, Nop10p family (PF04135; HMM-score: 14.5)
    Zn_Beta_Ribbon (CL0167) zf-ribbon_3; zinc-ribbon domain (PF13248; HMM-score: 14.4)
    zf-C4_Topoisom; Topoisomerase DNA binding C4 zinc finger (PF01396; HMM-score: 14.3)
    Nudix_N_2; Nudix N-terminal (PF14803; HMM-score: 14.2)
    no clan defined HypA; Hydrogenase/urease nickel incorporation, metallochaperone, hypA (PF01155; HMM-score: 13.6)
    DUF983; Protein of unknown function (DUF983) (PF06170; HMM-score: 12.3)
    Zn_Beta_Ribbon (CL0167) zf-RRN7; Zinc-finger of RNA-polymerase I-specific TFIIB, Rrn7 (PF11781; HMM-score: 12.1)
    no clan defined VP_N-CPKC; Virion protein N terminal domain (PF11475; HMM-score: 12)
    ADK_lid; Adenylate kinase, active site lid (PF05191; HMM-score: 11.5)
    Zn_Beta_Ribbon (CL0167) zf-NADH-PPase; NADH pyrophosphatase zinc ribbon domain (PF09297; HMM-score: 10.2)

Structure, modifications & cofactors[edit | edit source]

  • domains:
  • modifications:
  • cofactors:
  • effectors:

Localization[edit | edit source]

  • PSORTb: Cytoplasmic
    • Cytoplasmic Score: 9.67
    • Cytoplasmic Membrane Score: 0.01
    • Cellwall Score: 0.15
    • Extracellular Score: 0.17
    • Internal Helices: 0
  • LocateP:
  • SignalP: no predicted signal peptide
    • SP(Sec/SPI): 0.269171
    • TAT(Tat/SPI): 0.008157
    • LIPO(Sec/SPII): 0.045224
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit | edit source]

  • GI:
  • RefSeq: WP_001788193 NCBI
  • UniProt:

Protein sequence[edit | edit source]

  • MRKIPLNCEACGNRNYNVPKQEGSATRLTLKKYCPKCNAHTIHKESK

Experimental data[edit | edit source]

  • experimentally validated:
  • protein localization:
  • quantitative data / protein copy number per cell:
  • interaction partners:

Expression & Regulation[edit | edit source]

Operon[edit | edit source]

Regulation[edit | edit source]

  • regulator:

Transcription pattern[edit | edit source]

Protein synthesis (provided by Aureolib)[edit | edit source]

Protein stability[edit | edit source]

  • half-life: no data available

Biological Material[edit | edit source]

Mutants[edit | edit source]

Expression vector[edit | edit source]

lacZ fusion[edit | edit source]

GFP fusion[edit | edit source]

two-hybrid system[edit | edit source]

FLAG-tag construct[edit | edit source]

Antibody[edit | edit source]

Other Information[edit | edit source]

You are kindly invited to share additional interesting facts.

Literature[edit | edit source]

References[edit | edit source]

Relevant publications[edit | edit source]