From AureoWiki
Jump to: navigation, search
04-0298108BA0217611819-97685071193COLECT-R 2ED133ED98HO 5096 0412JH1JH9JKD6008JKD6159LGA251M013MRSA252MSHR1132MSSA476MW2Mu3Mu50N315NCTC8325NewmanRF122ST398T0131TCH60TW20USA300_FPR3757USA300_TCH1516VC40

NCBI: 02-MAR-2017

Summary[edit source | edit]

  • organism: Staphylococcus aureus N315
  • locus tag: SA_RS14600
  • pan locus tag?:
  • symbol: SA_RS14600
  • pan gene symbol?:
  • synonym:
  • product: hypothetical protein

Genome View[edit source | edit]

Gene[edit source | edit]

General[edit source | edit]

  • type: CDS
  • locus tag: SA_RS14600
  • symbol: SA_RS14600
  • product: hypothetical protein
  • replicon: chromosome
  • strand: +
  • coordinates: 831111..831296
  • length: 186
  • essential: unknown

Accession numbers[edit source | edit]

  • Location: NC_002745 (831111..831296) NCBI
  • BioCyc: G1G21-823 BioCyc
  • MicrobesOnline:

Phenotype[edit source | edit]

Share your knowledge and add information here. [edit]

DNA sequence[edit source | edit]

  • 1
    61
    121
    181
    GTGTTGGGGCCCCGCCAACTTGCACATTATTGTAAGCTGACTTTCCGCCAGCTTCTGTGT
    TGGGGCCCCACCCCAACTTGCATTGCCTGTAGAAATTGGAAATCCAATTTCTCTATGTTG
    GGGCCCCTGACTTTAATTGGAAAAAGCTTGTTACAAGTGCATTTTCGTTCGGTCAACTAC
    TACTAA
    60
    120
    180
    186

Protein[edit source | edit]

General[edit source | edit]

  • locus tag: SA_RS14600
  • symbol: SA_RS14600
  • description: hypothetical protein
  • length: 61
  • theoretical pI: 10.1377
  • theoretical MW: 7074.41
  • GRAVY: 0.0721311

Function[edit source | edit]

  • TIGRFAM:
    tungsten cofactor oxidoreducase radical SAM maturase (TIGR04317; HMM-score: 10.9)
  • TheSEED:
  • PFAM:
    no clan definedDUF3125; Protein of unknown function (DUF3125) (PF11323; HMM-score: 35.4)
    and 1 more
    GF_recep_C-rich (CL0547) GF_recep_IV; Growth factor receptor domain IV (PF14843; HMM-score: 14.5)

Structure, modifications & interactions[edit source | edit]

  • domains:
  • modifications:
  • cofactors:
  • effectors:
  • protein partners:

Localization[edit source | edit]

  • PSORTb: unknown (no significant prediction)
    • Cytoplasmic Score: 2.5
    • Cytoplasmic Membrane Score: 2.5
    • Cellwall Score: 2.5
    • Extracellular Score: 2.5
    • Internal Helices: 0
  • LocateP:
  • SignalP: no predicted signal peptide
    • SP(Sec/SPI): 0.030031
    • TAT(Tat/SPI): 0.00318
    • LIPO(Sec/SPII): 0.42735
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit source | edit]

  • GI:
  • RefSeq: WP_031807006 NCBI
  • UniProt:

Protein sequence[edit source | edit]

  • MLGPRQLAHYCKLTFRQLLCWGPTPTCIACRNWKSNFSMLGPLTLIGKSLLQVHFRSVNYY

Experimental data[edit source | edit]

  • experimentally validated: no data available

Expression & Regulation[edit source | edit]

Operon[edit source | edit]

Regulation[edit source | edit]

  • regulator:

Transcription pattern[edit source | edit]

Protein synthesis (provided by Aureolib)[edit source | edit]

Protein stability[edit source | edit]

  • half-life: no data available

Biological Material[edit source | edit]

Mutants[edit source | edit]

Expression vector[edit source | edit]

lacZ fusion[edit source | edit]

GFP fusion[edit source | edit]

two-hybrid system[edit source | edit]

FLAG-tag construct[edit source | edit]

Antibody[edit source | edit]

Other Information[edit source | edit]

You are kindly invited to share additional interesting facts.

Literature[edit source | edit]

References[edit source | edit]

Relevant publications[edit source | edit]