From AureoWiki
Jump to navigation Jump to search
COLN315NCTC8325NewmanUSA300_FPR3757JSNZ04-0298108BA0217611819-97685071193ECT-R 2ED133ED98HO 5096 0412JH1JH9JKD6008JKD6159LGA251M013MRSA252MSHR1132MSSA476MW2Mu3Mu50RF122ST398T0131TCH60TW20USA300_TCH1516VC40

NCBI: 02-MAR-2017

Summary[edit | edit source]

  • organism: Staphylococcus aureus N315
  • locus tag: SA_RS14640
  • pan locus tag?:
  • symbol: SA_RS14640
  • pan gene symbol?:
  • synonym:
  • product: poly(glycerol-phosphate) alpha-glucosyltransferase

Genome View[edit | edit source]

Gene[edit | edit source]

General[edit | edit source]

  • type: CDS
  • locus tag: SA_RS14640
  • symbol: SA_RS14640
  • product: poly(glycerol-phosphate) alpha-glucosyltransferase
  • replicon: chromosome
  • strand: +
  • coordinates: 1010781..1010918
  • length: 138
  • essential: unknown

Accession numbers[edit | edit source]

  • Location: NC_002745 (1010781..1010918) NCBI
  • BioCyc: SA_RS14640 BioCyc
  • MicrobesOnline:

Phenotype[edit | edit source]

Share your knowledge and add information here. [edit]

DNA sequence[edit | edit source]

  • 1
    61
    121
    ATGGCTGATAAAATACTAAAGCTTGTTAATAATGATGTTTTAGCAGAGGAGTTTGGTTCG
    AAAGCGAGAGAAAACATTATAGAAAAATATTCAACGGAATCAATATTAGAAAAATGGTTA
    AATCTTTTCAATAGCTAA
    60
    120
    138

Protein[edit | edit source]

General[edit | edit source]

  • locus tag: SA_RS14640
  • symbol: SA_RS14640
  • description: poly(glycerol-phosphate) alpha-glucosyltransferase
  • length: 45
  • theoretical pI: 4.56069
  • theoretical MW: 5214.92
  • GRAVY: -0.308889

Function[edit | edit source]

  • TIGRFAM:
    Metabolism Biosynthesis of cofactors, prosthetic groups, and carriers Glutathione and analogs N-acetyl-alpha-D-glucosaminyl L-malate synthase BshA (TIGR03999; EC 2.4.1.-; HMM-score: 16.9)
    sugar transferase, PEP-CTERM/EpsH1 system associated (TIGR03088; HMM-score: 16.1)
    Metabolism Energy metabolism Biosynthesis and degradation of polysaccharides glycogen synthase, Corynebacterium family (TIGR02149; HMM-score: 15.6)
    and 2 more
    sugar transferase, PEP-CTERM/EpsH1 system associated (TIGR03087; HMM-score: 13.4)
    glycosyltransferase, GG-Bacteroidales peptide system (TIGR04157; EC 2.4.1.-; HMM-score: 12.6)
  • TheSEED:
  • PFAM:
    no clan defined TnpW; Transposon-encoded protein TnpW (PF14202; HMM-score: 13.2)

Structure, modifications & cofactors[edit | edit source]

  • domains:
  • modifications:
  • cofactors:
  • effectors:

Localization[edit | edit source]

  • PSORTb: Cytoplasmic
    • Cytoplasmic Score: 7.5
    • Cytoplasmic Membrane Score: 1.15
    • Cellwall Score: 0.62
    • Extracellular Score: 0.73
    • Internal Helices: 0
  • DeepLocPro: Cytoplasmic
    • Cytoplasmic Score: 0.7823
    • Cytoplasmic Membrane Score: 0.0653
    • Cell wall & surface Score: 0.0002
    • Extracellular Score: 0.1521
  • LocateP:
  • SignalP: no predicted signal peptide
    • SP(Sec/SPI): 0.017002
    • TAT(Tat/SPI): 0.000867
    • LIPO(Sec/SPII): 0.003331
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit | edit source]

  • GI:
  • RefSeq: WP_001792054 NCBI
  • UniProt:

Protein sequence[edit | edit source]

  • MADKILKLVNNDVLAEEFGSKARENIIEKYSTESILEKWLNLFNS

Experimental data[edit | edit source]

  • experimentally validated:
  • protein localization:
  • quantitative data / protein copy number per cell:
  • interaction partners:

Expression & Regulation[edit | edit source]

Operon[edit | edit source]

Regulation[edit | edit source]

  • regulator:

Transcription pattern[edit | edit source]

Protein synthesis (provided by Aureolib)[edit | edit source]

Protein stability[edit | edit source]

  • half-life: no data available

Biological Material[edit | edit source]

Mutants[edit | edit source]

Expression vector[edit | edit source]

lacZ fusion[edit | edit source]

GFP fusion[edit | edit source]

two-hybrid system[edit | edit source]

FLAG-tag construct[edit | edit source]

Antibody[edit | edit source]

Other Information[edit | edit source]

You can add further information about the gene and protein here. [edit]

Literature[edit | edit source]

References[edit | edit source]

Relevant publications[edit | edit source]