Jump to navigation
Jump to search
COLN315NCTC8325NewmanUSA300_FPR3757JSNZ04-0298108BA0217611819-97685071193ECT-R 2ED133ED98HO 5096 0412JH1JH9JKD6008JKD6159LGA251M013MRSA252MSHR1132MSSA476MW2Mu3Mu50RF122ST398T0131TCH60TW20USA300_TCH1516VC40
NCBI: 02-MAR-2017
⊟Summary[edit | edit source]
- organism: Staphylococcus aureus N315
- locus tag: SA_RS14890
- pan locus tag?:
- symbol: SA_RS14890
- pan gene symbol?: —
- synonym:
- product: HNH endonuclease
⊟Additional information (user-provided)[edit | edit source]
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: SA_RS14890
- symbol: SA_RS14890
- product: HNH endonuclease
- replicon: chromosome
- strand: -
- coordinates: 2285338..2285499
- length: 162
- essential: unknown
⊟Accession numbers[edit | edit source]
⊟Phenotype[edit | edit source]
⊟Additional information (user-provided)[edit | edit source]
⊟DNA sequence[edit | edit source]
- 1
61
121ATTTGTAATACAGATTTACAATATGATCACCAAACACATATATGGAATTATAAAGATATG
GTAGGAGATCATATTATACCATGGAGTAAAGGTGGAAAAACAGAGCGTGGAAACTTACAG
ATGCTTTATAAACATCATAATAGTCTAAAATCCAATTACTAG60
120
162
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: SA_RS14890
- symbol: SA_RS14890
- description: HNH endonuclease
- length: 53
- theoretical pI: 8.48949
- theoretical MW: 6348.1
- GRAVY: -1.11509
⊟Function[edit | edit source]
- TIGRFAM:
- TheSEED:
- PFAM: His-Me_finger (CL0263) HNH; HNH endonuclease (PF01844; HMM-score: 32.6)and 2 moreHNH_5; HNH endonuclease (PF14279; HMM-score: 21)HNH_4; HNH endonuclease (PF13395; HMM-score: 17)
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
⊟Localization[edit | edit source]
- PSORTb: Extracellular
- Cytoplasmic Score: 0.24
- Cytoplasmic Membrane Score: 0.05
- Cellwall Score: 0.8
- Extracellular Score: 8.91
- Internal Helices: 0
- DeepLocPro: Cytoplasmic
- Cytoplasmic Score: 0.8497
- Cytoplasmic Membrane Score: 0.0002
- Cell wall & surface Score: 0.0011
- Extracellular Score: 0.149
- LocateP:
- SignalP: no predicted signal peptide
- SP(Sec/SPI): 0.090786
- TAT(Tat/SPI): 0.003299
- LIPO(Sec/SPII): 0.012662
- predicted transmembrane helices (TMHMM): 0
⊟Accession numbers[edit | edit source]
- GI:
- RefSeq: WP_071621402 NCBI
- UniProt:
⊟Additional information (user-provided)[edit | edit source]
⊟Protein sequence[edit | edit source]
- MCNTDLQYDHQTHIWNYKDMVGDHIIPWSKGGKTERGNLQMLYKHHNSLKSNY
⊟Experimental data[edit | edit source]
- experimentally validated:
- protein localization:
- quantitative data / protein copy number per cell:
- interaction partners:
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
⊟Regulation[edit | edit source]
- regulator:
⊟Additional information (user-provided)[edit | edit source]
⊟Transcription pattern[edit | edit source]
- S.aureus Expression Data Browser: no data available
⊟Protein synthesis (provided by Aureolib)[edit | edit source]
- Aureolib: no data available
⊟Protein stability[edit | edit source]
- half-life: no data available
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Additional information (user-provided)[edit | edit source]
⊟Other information (user-provided)[edit | edit source]
You can add further information about the gene and protein here. [edit]
⊟Literature[edit | edit source]
⊟References[edit | edit source]