Jump to navigation
Jump to search
NCBI: 06-JUL-2013
⊟Summary[edit | edit source]
- organism: Staphylococcus aureus Newman
- locus tag: NWMN_0308 [new locus tag: NWMN_RS01755 ]
- pan locus tag?: SAUPAN000622000
- symbol: NWMN_0308
- pan gene symbol?: —
- synonym:
- product: hypothetical protein
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: NWMN_0308 [new locus tag: NWMN_RS01755 ]
- symbol: NWMN_0308
- product: hypothetical protein
- replicon: chromosome
- strand: +
- coordinates: 357446..357745
- length: 300
- essential: unknown
⊟Accession numbers[edit | edit source]
- Gene ID: 5330147 NCBI
- RefSeq: YP_001331342 NCBI
- BioCyc:
- MicrobesOnline: 3705839 MicrobesOnline
⊟Phenotype[edit | edit source]
Share your knowledge and add information here. [edit]
⊟DNA sequence[edit | edit source]
- 1
61
121
181
241ATGTTTGGATTTACCAAACGACATGAACAAGATTGGCGTTTAACGCGATTAGAAGAAAAT
GATAAGACTATGTTTGAAAAATTCGACAGAATAGAAGATAGTCTTAGAGCGCAAGAAAAG
ATTTATGACAAATTAGATAGAAATTTTGAAGAATTAAAGCGCGACAAGGTAGAAGATGAA
AAGAATAAAGAAAAGAATGCCAAGAATATTAGAGACATAAAAATGTGGATTCTAGGTTTG
ATAGGGACTATCTTCAGTACGATTGTCATAGCTTTACTAAGAACTGTTTTTGGTATTTAA60
120
180
240
300
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: NWMN_0308 [new locus tag: NWMN_RS01755 ]
- symbol: NWMN_0308
- description: hypothetical protein
- length: 99
- theoretical pI: 9.02274
- theoretical MW: 12010.8
- GRAVY: -0.737374
⊟Function[edit | edit source]
- TIGRFAM: DNA metabolism Other MutS2 family protein (TIGR01069; HMM-score: 8.5)
- TheSEED:
- PFAM: no clan defined DUF2951; Protein of unknown function (DUF2951) (PF11166; HMM-score: 178.4)and 6 moreXhlA; Haemolysin XhlA (PF10779; HMM-score: 16.2)Vps51 (CL0295) Sec3_C_2; Sec3 exocyst complex subunit (PF15278; HMM-score: 14.7)no clan defined Polysacc_synt_4; Polysaccharide biosynthesis (PF04669; HMM-score: 14.5)TelA; Toxic anion resistance protein (TelA) (PF05816; HMM-score: 13.3)DUF2207; Predicted membrane protein (DUF2207) (PF09972; HMM-score: 12.4)DRAT; Dinitrogenase reductase ADP-ribosyltransferase (DRAT) (PF07357; HMM-score: 11.3)
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
⊟Localization[edit | edit source]
- PSORTb: Cytoplasmic Membrane
- Cytoplasmic Score: 1.78
- Cytoplasmic Membrane Score: 8.16
- Cellwall Score: 0.06
- Extracellular Score: 0.01
- Internal Helix: 1
- LocateP: Intracellular /TMH start AFTER 60
- Prediction by SwissProt Classification: Cytoplasmic
- Pathway Prediction: Possibly Sec-
- Intracellular possibility: 0.17
- Signal peptide possibility: -1
- N-terminally Anchored Score: 1
- Predicted Cleavage Site: No CleavageSite
- SignalP: no predicted signal peptide
- SP(Sec/SPI): 0.002331
- TAT(Tat/SPI): 0.000943
- LIPO(Sec/SPII): 0.00094
- predicted transmembrane helices (TMHMM): 1
⊟Accession numbers[edit | edit source]
⊟Protein sequence[edit | edit source]
- MFGFTKRHEQDWRLTRLEENDKTMFEKFDRIEDSLRAQEKIYDKLDRNFEELKRDKVEDEKNKEKNAKNIRDIKMWILGLIGTIFSTIVIALLRTVFGI
⊟Experimental data[edit | edit source]
- experimentally validated:
- protein localization:
- quantitative data / protein copy number per cell:
- interaction partners:
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
- MicrobesOnline: no polycistronic organisation predicted
⊟Regulation[edit | edit source]
- regulator:
⊟Transcription pattern[edit | edit source]
- S.aureus Expression Data Browser: no data available
⊟Protein synthesis (provided by Aureolib)[edit | edit source]
- Aureolib: no data available
⊟Protein stability[edit | edit source]
- half-life: no data available
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Other Information[edit | edit source]
You are kindly invited to share additional interesting facts.