From AureoWiki
Jump to navigation Jump to search
PangenomeCOLN315NCTC8325NewmanUSA300_FPR375704-0298108BA0217611819-97685071193ECT-R 2ED133ED98HO 5096 0412JH1JH9JKD6008JKD6159LGA251M013MRSA252MSHR1132MSSA476MW2Mu3Mu50RF122ST398T0131TCH60TW20USA300_TCH1516VC40

NCBI: 10-JUN-2013

Summary[edit | edit source]

  • organism: Staphylococcus aureus USA300_FPR3757
  • locus tag: SAUSA300_1433 [new locus tag: SAUSA300_RS07820 ]
  • pan locus tag?: SAUPAN001313000
  • symbol: SAUSA300_1433
  • pan gene symbol?:
  • synonym:
  • product: putative phage regulatory protein

Genome View[edit | edit source]

Gene[edit | edit source]

General[edit | edit source]

  • type: CDS
  • locus tag: SAUSA300_1433 [new locus tag: SAUSA300_RS07820 ]
  • symbol: SAUSA300_1433
  • product: putative phage regulatory protein
  • replicon: chromosome
  • strand: -
  • coordinates: 1587729..1587929
  • length: 201
  • essential: unknown

Accession numbers[edit | edit source]

Phenotype[edit | edit source]

Share your knowledge and add information here. [edit]

DNA sequence[edit | edit source]

  • 1
    61
    121
    181
    GTGGACGACATGCCGGAACAATTATCCGTAAGAAAATGGAGACTTGTAAGGGACTTGAAA
    CAGCAAGAAGTAGCAGATATATTGGGCGTCAATGCAAAGACAGTTGGTCATTGGGAAAAG
    GATGACACTAATTTAAGTAATGTTACAGTTTACGCTTTAGCAAAGTTATATGATATTGAG
    GTAGACCAGATAAAGGTCTAA
    60
    120
    180
    201

Protein[edit | edit source]

General[edit | edit source]

  • locus tag: SAUSA300_1433 [new locus tag: SAUSA300_RS07820 ]
  • symbol: SAUSA300_1433
  • description: putative phage regulatory protein
  • length: 66
  • theoretical pI: 4.68848
  • theoretical MW: 7642.67
  • GRAVY: -0.427273

Function[edit | edit source]

  • TIGRFAM:
    putative zinc finger/helix-turn-helix protein, YgiT family (TIGR03830; HMM-score: 24.3)
    Signal transduction Regulatory functions DNA interactions transcriptional regulator, y4mF family (TIGR03070; HMM-score: 22.1)
    and 1 more
    RNA polymerase sigma factor, sigma-70 family (TIGR02937; HMM-score: 15)
  • TheSEED  :
    • Phage transcriptional regulator cro
  • PFAM:
    HTH (CL0123) HTH_3; Helix-turn-helix (PF01381; HMM-score: 37.2)
    and 13 more
    HTH_31; Helix-turn-helix domain (PF13560; HMM-score: 27.2)
    HTH_19; Helix-turn-helix domain (PF12844; HMM-score: 22.6)
    HTH_23; Homeodomain-like domain (PF13384; HMM-score: 19)
    Phage_terminase; Phage terminase small subunit (PF10668; HMM-score: 16.5)
    MerR_1; MerR HTH family regulatory protein (PF13411; HMM-score: 16.3)
    HTH_17; Helix-turn-helix domain (PF12728; HMM-score: 15.8)
    MerR; MerR family regulatory protein (PF00376; HMM-score: 15.5)
    HTH_25; Helix-turn-helix domain (PF13413; HMM-score: 14.8)
    HTH_26; Cro/C1-type HTH DNA-binding domain (PF13443; HMM-score: 14.4)
    Sigma70_r4_2; Sigma-70, region 4 (PF08281; HMM-score: 14)
    DUF1870; Domain of unknown function (DUF1870) (PF08965; HMM-score: 13.6)
    Phage_CI_repr; Bacteriophage CI repressor helix-turn-helix domain (PF07022; HMM-score: 13)
    Sigma70_r4; Sigma-70, region 4 (PF04545; HMM-score: 12.6)

Structure, modifications & cofactors[edit | edit source]

  • domains:
  • modifications:
  • cofactors:
  • effectors:

Localization[edit | edit source]

  • PSORTb: Cytoplasmic
    • Cytoplasmic Score: 7.5
    • Cytoplasmic Membrane Score: 1.15
    • Cellwall Score: 0.62
    • Extracellular Score: 0.73
    • Internal Helices: 0
  • LocateP: Intracellular
    • Prediction by SwissProt Classification: Cytoplasmic
    • Pathway Prediction: No pathway
    • Intracellular possibility: 1
    • Signal peptide possibility: -1
    • N-terminally Anchored Score: 1
    • Predicted Cleavage Site: No CleavageSite
  • SignalP: no predicted signal peptide
    • SP(Sec/SPI): 0.002751
    • TAT(Tat/SPI): 0.000248
    • LIPO(Sec/SPII): 0.000407
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit | edit source]

Protein sequence[edit | edit source]

  • MDDMPEQLSVRKWRLVRDLKQQEVADILGVNAKTVGHWEKDDTNLSNVTVYALAKLYDIEVDQIKV

Experimental data[edit | edit source]

  • experimentally validated:
  • protein localization:
  • quantitative data / protein copy number per cell:
  • interaction partners:

Expression & Regulation[edit | edit source]

Operon[edit | edit source]

Regulation[edit | edit source]

  • regulator:

Transcription pattern[edit | edit source]

Protein synthesis (provided by Aureolib)[edit | edit source]

Protein stability[edit | edit source]

  • half-life: no data available

Biological Material[edit | edit source]

Mutants[edit | edit source]

Expression vector[edit | edit source]

lacZ fusion[edit | edit source]

GFP fusion[edit | edit source]

two-hybrid system[edit | edit source]

FLAG-tag construct[edit | edit source]

Antibody[edit | edit source]

Other Information[edit | edit source]

You are kindly invited to share additional interesting facts.

Literature[edit | edit source]

References[edit | edit source]

Relevant publications[edit | edit source]