Jump to navigation
Jump to search
PangenomeCOLN315NCTC8325NewmanUSA300_FPR375704-0298108BA0217611819-97685071193ECT-R 2ED133ED98HO 5096 0412JH1JH9JKD6008JKD6159LGA251M013MRSA252MSHR1132MSSA476MW2Mu3Mu50RF122ST398T0131TCH60TW20USA300_TCH1516VC40
NCBI: 10-JUN-2013
⊟Summary[edit | edit source]
- organism: Staphylococcus aureus USA300_FPR3757
- locus tag: SAUSA300_1433 [new locus tag: SAUSA300_RS07820 ]
- pan locus tag?: SAUPAN001313000
- symbol: SAUSA300_1433
- pan gene symbol?: —
- synonym:
- product: putative phage regulatory protein
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: SAUSA300_1433 [new locus tag: SAUSA300_RS07820 ]
- symbol: SAUSA300_1433
- product: putative phage regulatory protein
- replicon: chromosome
- strand: -
- coordinates: 1587729..1587929
- length: 201
- essential: unknown
⊟Accession numbers[edit | edit source]
- Gene ID: 3915285 NCBI
- RefSeq: YP_494130 NCBI
- BioCyc: GH3C-1428 BioCyc
- MicrobesOnline: 1292948 MicrobesOnline
⊟Phenotype[edit | edit source]
Share your knowledge and add information here. [edit]
⊟DNA sequence[edit | edit source]
- 1
61
121
181GTGGACGACATGCCGGAACAATTATCCGTAAGAAAATGGAGACTTGTAAGGGACTTGAAA
CAGCAAGAAGTAGCAGATATATTGGGCGTCAATGCAAAGACAGTTGGTCATTGGGAAAAG
GATGACACTAATTTAAGTAATGTTACAGTTTACGCTTTAGCAAAGTTATATGATATTGAG
GTAGACCAGATAAAGGTCTAA60
120
180
201
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: SAUSA300_1433 [new locus tag: SAUSA300_RS07820 ]
- symbol: SAUSA300_1433
- description: putative phage regulatory protein
- length: 66
- theoretical pI: 4.68848
- theoretical MW: 7642.67
- GRAVY: -0.427273
⊟Function[edit | edit source]
- TIGRFAM: putative zinc finger/helix-turn-helix protein, YgiT family (TIGR03830; HMM-score: 24.3)Regulatory functions DNA interactions transcriptional regulator, y4mF family (TIGR03070; HMM-score: 22.1)and 1 moreRNA polymerase sigma factor, sigma-70 family (TIGR02937; HMM-score: 15)
- TheSEED :
- Phage transcriptional regulator cro
- PFAM: HTH (CL0123) HTH_3; Helix-turn-helix (PF01381; HMM-score: 37.2)and 13 moreHTH_31; Helix-turn-helix domain (PF13560; HMM-score: 27.2)HTH_19; Helix-turn-helix domain (PF12844; HMM-score: 22.6)HTH_23; Homeodomain-like domain (PF13384; HMM-score: 19)Phage_terminase; Phage terminase small subunit (PF10668; HMM-score: 16.5)MerR_1; MerR HTH family regulatory protein (PF13411; HMM-score: 16.3)HTH_17; Helix-turn-helix domain (PF12728; HMM-score: 15.8)MerR; MerR family regulatory protein (PF00376; HMM-score: 15.5)HTH_25; Helix-turn-helix domain (PF13413; HMM-score: 14.8)HTH_26; Cro/C1-type HTH DNA-binding domain (PF13443; HMM-score: 14.4)Sigma70_r4_2; Sigma-70, region 4 (PF08281; HMM-score: 14)DUF1870; Domain of unknown function (DUF1870) (PF08965; HMM-score: 13.6)Phage_CI_repr; Bacteriophage CI repressor helix-turn-helix domain (PF07022; HMM-score: 13)Sigma70_r4; Sigma-70, region 4 (PF04545; HMM-score: 12.6)
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
⊟Localization[edit | edit source]
- PSORTb: Cytoplasmic
- Cytoplasmic Score: 7.5
- Cytoplasmic Membrane Score: 1.15
- Cellwall Score: 0.62
- Extracellular Score: 0.73
- Internal Helices: 0
- LocateP: Intracellular
- Prediction by SwissProt Classification: Cytoplasmic
- Pathway Prediction: No pathway
- Intracellular possibility: 1
- Signal peptide possibility: -1
- N-terminally Anchored Score: 1
- Predicted Cleavage Site: No CleavageSite
- SignalP: no predicted signal peptide
- SP(Sec/SPI): 0.002751
- TAT(Tat/SPI): 0.000248
- LIPO(Sec/SPII): 0.000407
- predicted transmembrane helices (TMHMM): 0
⊟Accession numbers[edit | edit source]
⊟Protein sequence[edit | edit source]
- MDDMPEQLSVRKWRLVRDLKQQEVADILGVNAKTVGHWEKDDTNLSNVTVYALAKLYDIEVDQIKV
⊟Experimental data[edit | edit source]
- experimentally validated:
- protein localization:
- quantitative data / protein copy number per cell:
- interaction partners:
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
- MicrobesOnline: no polycistronic organisation predicted
⊟Regulation[edit | edit source]
- regulator:
⊟Transcription pattern[edit | edit source]
- S.aureus Expression Data Browser: no data available
⊟Protein synthesis (provided by Aureolib)[edit | edit source]
- Aureolib: no data available
⊟Protein stability[edit | edit source]
- half-life: no data available
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Other Information[edit | edit source]
You are kindly invited to share additional interesting facts.