From AureoWiki
Jump to navigation Jump to search

NCBI: 02-MAR-2017

Summary[edit | edit source]

  • organism: Staphylococcus aureus N315
  • locus tag: SA_RS02165 [old locus tag: SA0379 ]
  • pan locus tag?: SAUPAN002057000
  • symbol: SA_RS02165
  • pan gene symbol?:
  • synonym:
  • product: transposase

Genome View[edit | edit source]

Gene[edit | edit source]

General[edit | edit source]

  • type: CDS
  • locus tag: SA_RS02165 [old locus tag: SA0379 ]
  • symbol: SA_RS02165
  • product: transposase
  • replicon: chromosome
  • strand: -
  • coordinates: 438190..438462
  • length: 273
  • essential: no DEG other strains

Accession numbers[edit | edit source]

  • Location: NC_002745 (438190..438462) NCBI
  • BioCyc: G1G21-415 BioCyc
  • MicrobesOnline: see SA0379

Phenotype[edit | edit source]

Share your knowledge and add information here. [edit]

DNA sequence[edit | edit source]

  • 1
    61
    121
    181
    241
    ATGACAAAAGAAAGAAGAACATTTAGTTCAGAGTTTAAGTTACAAATGGTTAGATTATAT
    AAAAATGGTAAGCTTAAGAATGAAATTATACGAAAGTATGATTTAAAACCCTCAATTATC
    TCAAATTCGATAAAACAACACCAAAATACTGGACCCTTCAATCATCAAGATAATTTAAAA
    AGTGATGAAAAAGAGTTAATAAAATTACGCAAAGAAGTTCAACATTTAAAAATGGAACAT
    GATGTTTTAAAGCAAATTTTAAAGTTGATTTAG
    60
    120
    180
    240
    273

Protein[edit | edit source]

General[edit | edit source]

  • locus tag: SA_RS02165 [old locus tag: SA0379 ]
  • symbol: SA_RS02165
  • description: transposase
  • length: 90
  • theoretical pI: 10.6672
  • theoretical MW: 10830.6
  • GRAVY: -0.925556

Function[edit | edit source]

  • TIGRFAM:
  • TheSEED: see SA0379
  • PFAM:
    HTH (CL0123) HTH_Tnp_1; Transposase (PF01527; HMM-score: 37.9)
    and 2 more
    CENP-B_N; CENP-B N-terminal DNA-binding domain (PF04218; HMM-score: 13.7)
    BrkDBD; Brinker DNA-binding domain (PF09607; HMM-score: 12.1)

Structure, modifications & cofactors[edit | edit source]

  • domains:
  • modifications:
  • cofactors:
  • effectors:

Localization[edit | edit source]

  • PSORTb: Cytoplasmic
    • Cytoplasmic Score: 7.5
    • Cytoplasmic Membrane Score: 1.15
    • Cellwall Score: 0.62
    • Extracellular Score: 0.73
    • Internal Helices: 0
  • LocateP:
  • SignalP: no predicted signal peptide
    • SP(Sec/SPI): 0.004697
    • TAT(Tat/SPI): 0.000704
    • LIPO(Sec/SPII): 0.001941
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit | edit source]

Protein sequence[edit | edit source]

  • MTKERRTFSSEFKLQMVRLYKNGKLKNEIIRKYDLKPSIISNSIKQHQNTGPFNHQDNLKSDEKELIKLRKEVQHLKMEHDVLKQILKLI

Experimental data[edit | edit source]

  • experimentally validated:
  • protein localization: data available for COL
  • quantitative data / protein copy number per cell:
  • interaction partners:

Expression & Regulation[edit | edit source]

Operon[edit | edit source]

Regulation[edit | edit source]

  • regulator:

Transcription pattern[edit | edit source]

Protein synthesis (provided by Aureolib)[edit | edit source]

Protein stability[edit | edit source]

  • half-life: no data available

Biological Material[edit | edit source]

Mutants[edit | edit source]

Expression vector[edit | edit source]

lacZ fusion[edit | edit source]

GFP fusion[edit | edit source]

two-hybrid system[edit | edit source]

FLAG-tag construct[edit | edit source]

Antibody[edit | edit source]

Other Information[edit | edit source]

You are kindly invited to share additional interesting facts.

Literature[edit | edit source]

References[edit | edit source]

Relevant publications[edit | edit source]