From AureoWiki
Jump to navigation Jump to search
(Created page with "<protect> =Summary= * <aureodatabase>organism</aureodatabase> * <aureodatabase>locus</aureodatabase> * <aureodatabase>pan locus</aureodatabase> * <aureodatabase>gene symbol</...")
 
m (Text replacement - "<protect> =Summary= * <aureodatabase>organism" to "<protect> <aureodatabase>NCBI date</aureodatabase> =Summary= * <aureodatabase>organism")
Line 1: Line 1:
<protect>
<protect>
<aureodatabase>NCBI date</aureodatabase>
=Summary=
=Summary=



Revision as of 15:22, 11 January 2016

PangenomeCOLN315NCTC8325NewmanUSA300_FPR375704-0298108BA0217611819-97685071193ECT-R 2ED133ED98HO 5096 0412JH1JH9JKD6008JKD6159JSNZLGA251M013MRSA252MSHR1132MSSA476MW2Mu3Mu50RF122ST398T0131TCH60TW20USA300_TCH1516VC40

Genome View[edit | edit source]

Gene[edit | edit source]

General[edit | edit source]

  • type: CDS
  • locus tag: NWMN_0308 [new locus tag: NWMN_RS01755 ]
  • symbol: NWMN_0308
  • product: hypothetical protein
  • replicon: chromosome
  • strand: +
  • coordinates: 357446..357745
  • length: 300
  • essential: unknown

Accession numbers[edit | edit source]

  • Gene ID: 5330147 NCBI
  • gene Genbank : _

Phenotype[edit | edit source]

  • Share your knowledge and add information here. [edit]

DNA sequence[edit | edit source]

  • 1
    61
    121
    181
    241
    ATGTTTGGATTTACCAAACGACATGAACAAGATTGGCGTTTAACGCGATTAGAAGAAAAT
    GATAAGACTATGTTTGAAAAATTCGACAGAATAGAAGATAGTCTTAGAGCGCAAGAAAAG
    ATTTATGACAAATTAGATAGAAATTTTGAAGAATTAAAGCGCGACAAGGTAGAAGATGAA
    AAGAATAAAGAAAAGAATGCCAAGAATATTAGAGACATAAAAATGTGGATTCTAGGTTTG
    ATAGGGACTATCTTCAGTACGATTGTCATAGCTTTACTAAGAACTGTTTTTGGTATTTAA
    60
    120
    180
    240
    300

Protein[edit | edit source]

General[edit | edit source]

  • locus tag: NWMN_0308 [new locus tag: NWMN_RS01755 ]
  • symbol: NWMN_0308
  • description: hypothetical protein
  • length: 99
  • theoretical pI: 9.02274
  • theoretical MW: 12010.8
  • GRAVY: -0.737374

Function[edit | edit source]

  • TIGRFAM:
    Genetic information processing DNA metabolism Other MutS2 family protein (TIGR01069; HMM-score: 8.5)
  • TheSEED  :
    • Phage phi 11 orf48 protein homolog
  • PFAM:
    no clan defined DUF2951; Protein of unknown function (DUF2951) (PF11166; HMM-score: 178.4)
    and 10 more
    XhlA; Haemolysin XhlA (PF10779; HMM-score: 19.9)
    MpPF26; M penetrans paralogue family 26 (PF07666; HMM-score: 17.4)
    TUNAR; TUNAR (PF21954; HMM-score: 15.6)
    TPR (CL0020) Sec3_C_2; Sec3 exocyst complex subunit (PF15278; HMM-score: 14.7)
    no clan defined TelA; Toxic anion resistance protein (TelA) (PF05816; HMM-score: 14.3)
    DUF2207_C; Predicted membrane protein (DUF2207) C-terminal domain (PF20990; HMM-score: 13.6)
    YxiF; YxiF protein (PF24715; HMM-score: 13.6)
    Cyclin (CL0065) DUF3452; Domain of unknown function (DUF3452) (PF11934; HMM-score: 13.4)
    no clan defined DRAT; Dinitrogenase reductase ADP-ribosyltransferase (DRAT) (PF07357; HMM-score: 11.5)
    PBDC1; PBDC1 protein (PF04669; HMM-score: 11.1)

Structure, modifications & interactions[edit | edit source]

  • domains:
  • modifications:
  • cofactors:
  • effectors:
  • interaction partners:

Localization[edit | edit source]

  • PSORTb: Cytoplasmic Membrane
    • Cytoplasmic Score: 1.78
    • Cytoplasmic Membrane Score: 8.16
    • Cellwall Score: 0.06
    • Extracellular Score: 0.01
    • Internal Helix: 1
  • LocateP: Intracellular /TMH start AFTER 60
    • Prediction by SwissProt Classification: Cytoplasmic
    • Pathway Prediction: Possibly Sec-
    • Intracellular possibility: 0.17
    • Signal peptide possibility: -1
    • N-terminally Anchored Score: 1
    • Predicted Cleavage Site: No CleavageSite
  • SignalP: no predicted signal peptide
    • SP(Sec/SPI): 0.002331
    • TAT(Tat/SPI): 0.000943
    • LIPO(Sec/SPII): 0.00094
  • predicted transmembrane helices (TMHMM): 1

Accession numbers[edit | edit source]

  • GI: 151220520 NCBI
  • UniProt: A0A0H3KAN8 UniProt
  • protein Genbank : _
  • RefSeq: YP_001331342 NCBI

Protein sequence[edit | edit source]

  • MFGFTKRHEQDWRLTRLEENDKTMFEKFDRIEDSLRAQEKIYDKLDRNFEELKRDKVEDEKNKEKNAKNIRDIKMWILGLIGTIFSTIVIALLRTVFGI

Peptides[edit | edit source]

  • experimentally validated:

Expression & Regulation[edit | edit source]

Operon[edit | edit source]

Regulation[edit | edit source]

  • sigma factors : _
  • regulator:

Transcription pattern[edit | edit source]

Protein synthesis (provided by Aureolib)[edit | edit source]

Stability[edit | edit source]

  • half-life: no data available

Biological Material[edit | edit source]

Mutants[edit | edit source]

Expression vector[edit | edit source]

lacZ fusion[edit | edit source]

GFP fusion[edit | edit source]

two-hybrid system[edit | edit source]

FLAG-tag construct[edit | edit source]

Antibody[edit | edit source]

Other Information[edit | edit source]

You are kindly invited to share additional interesting facts.

Literature[edit | edit source]

References[edit | edit source]

Relevant publications[edit | edit source]