From AureoWiki
Revision as of 09:10, 11 March 2016 by AureoSysAdmin (talk | contribs) (Text replacement - "* <aureodatabase>protein Genbank</aureodatabase> " to "")
(diff) ← Older revision | Latest revision (diff) | Newer revision → (diff)
Jump to navigation Jump to search
PangenomeCOLN315NCTC8325NewmanUSA300_FPR375704-0298108BA0217611819-97685071193ECT-R 2ED133ED98HO 5096 0412JH1JH9JKD6008JKD6159LGA251M013MRSA252MSHR1132MSSA476MW2Mu3Mu50RF122ST398T0131TCH60TW20USA300_TCH1516VC40

Genome View[edit | edit source]

Gene[edit | edit source]

General[edit | edit source]

  • type: CDS
  • locus tag: SAUSA300_RS07820 [old locus tag: SAUSA300_1433 ]
  • symbol: SAUSA300_RS07820
  • product: transcriptional regulator
  • replicon: chromosome
  • strand: -
  • coordinates: 1587729..1587920
  • length: 192
  • essential: unknown

Accession numbers[edit | edit source]

Phenotype[edit | edit source]

Share your knowledge and add information here. [edit]

DNA sequence[edit | edit source]

  • 1
    61
    121
    181
    ATGCCGGAACAATTATCCGTAAGAAAATGGAGACTTGTAAGGGACTTGAAACAGCAAGAA
    GTAGCAGATATATTGGGCGTCAATGCAAAGACAGTTGGTCATTGGGAAAAGGATGACACT
    AATTTAAGTAATGTTACAGTTTACGCTTTAGCAAAGTTATATGATATTGAGGTAGACCAG
    ATAAAGGTCTAA
    60
    120
    180
    192

Protein[edit | edit source]

General[edit | edit source]

  • locus tag: SAUSA300_RS07820 [old locus tag: SAUSA300_1433 ]
  • symbol: SAUSA300_RS07820
  • description: transcriptional regulator
  • length: 63
  • theoretical pI: 5.78693
  • theoretical MW: 7281.3
  • GRAVY: -0.366667

Function[edit | edit source]

  • TIGRFAM:
    putative zinc finger/helix-turn-helix protein, YgiT family (TIGR03830; HMM-score: 24)
    Signal transduction Regulatory functions DNA interactions transcriptional regulator, y4mF family (TIGR03070; HMM-score: 22.3)
    and 1 more
    RNA polymerase sigma factor, sigma-70 family (TIGR02937; HMM-score: 14.8)
  • TheSEED: see SAUSA300_1433
  • PFAM:
    HTH (CL0123) HTH_3; Helix-turn-helix (PF01381; HMM-score: 37.4)
    and 13 more
    HTH_31; Helix-turn-helix domain (PF13560; HMM-score: 27.4)
    HTH_19; Helix-turn-helix domain (PF12844; HMM-score: 22.8)
    HTH_23; Homeodomain-like domain (PF13384; HMM-score: 19.2)
    MerR_1; MerR HTH family regulatory protein (PF13411; HMM-score: 16.5)
    Phage_terminase; Phage terminase small subunit (PF10668; HMM-score: 16.3)
    HTH_17; Helix-turn-helix domain (PF12728; HMM-score: 16)
    MerR; MerR family regulatory protein (PF00376; HMM-score: 15.7)
    HTH_25; Helix-turn-helix domain (PF13413; HMM-score: 14.9)
    HTH_26; Cro/C1-type HTH DNA-binding domain (PF13443; HMM-score: 14.6)
    Sigma70_r4_2; Sigma-70, region 4 (PF08281; HMM-score: 14.2)
    DUF1870; Domain of unknown function (DUF1870) (PF08965; HMM-score: 13.7)
    Phage_CI_repr; Bacteriophage CI repressor helix-turn-helix domain (PF07022; HMM-score: 13.1)
    Sigma70_r4; Sigma-70, region 4 (PF04545; HMM-score: 12.7)

Structure, modifications & cofactors[edit | edit source]

  • domains:
  • modifications:
  • cofactors:
  • effectors:

Localization[edit | edit source]

  • PSORTb: unknown (no significant prediction)
    • Cytoplasmic Score: 2.5
    • Cytoplasmic Membrane Score: 2.5
    • Cellwall Score: 2.5
    • Extracellular Score: 2.5
    • Internal Helices: 0
  • LocateP:
  • SignalP: no predicted signal peptide
    • SP(Sec/SPI): 0.003676
    • TAT(Tat/SPI): 0.000258
    • LIPO(Sec/SPII): 0.000615
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit | edit source]

Protein sequence[edit | edit source]

  • MPEQLSVRKWRLVRDLKQQEVADILGVNAKTVGHWEKDDTNLSNVTVYALAKLYDIEVDQIKV

Experimental data[edit | edit source]

  • experimentally validated:
  • protein localization:
  • quantitative data / protein copy number per cell:
  • interaction partners:

Expression & Regulation[edit | edit source]

Operon[edit | edit source]

Regulation[edit | edit source]

  • regulator:

Transcription pattern[edit | edit source]

Protein synthesis (provided by Aureolib)[edit | edit source]

Protein stability[edit | edit source]

  • half-life: no data available

Biological Material[edit | edit source]

Mutants[edit | edit source]

Expression vector[edit | edit source]

lacZ fusion[edit | edit source]

GFP fusion[edit | edit source]

two-hybrid system[edit | edit source]

FLAG-tag construct[edit | edit source]

Antibody[edit | edit source]

Other Information[edit | edit source]

You are kindly invited to share additional interesting facts.

Literature[edit | edit source]

References[edit | edit source]

Relevant publications[edit | edit source]