Jump to navigation
Jump to search
PangenomeCOLN315NCTC8325NewmanUSA300_FPR3757JSNZ04-0298108BA0217611819-97685071193ECT-R 2ED133ED98HO 5096 0412JH1JH9JKD6008JKD6159LGA251M013MRSA252MSHR1132MSSA476MW2Mu3Mu50RF122ST398T0131TCH60TW20USA300_TCH1516VC40
NCBI: 01-DEC-2025
⊟Summary[edit | edit source]
- organism: Staphylococcus aureus JSNZ
- locus tag: EGJ38_000812 [new locus tag: EGJ38_RS04055 ]
- pan locus tag?: SAUPAN006540000
- symbol: EGJ38_000812
- pan gene symbol?: —
- synonym:
- alternate name: JSNZ_000812
- product: hypothetical protein
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: EGJ38_000812 [new locus tag: EGJ38_RS04055 ]
- symbol: EGJ38_000812
- product: hypothetical protein
- replicon: chromosome
- strand: -
- coordinates: 840299..840481
- length: 183
- essential: unknown
⊟Accession numbers[edit | edit source]
- Gene ID:
- RefSeq: MGT2422787 NCBI
- BioCyc:
- MicrobesOnline:
⊟Phenotype[edit | edit source]
Share your knowledge and add information here. [edit]
⊟DNA sequence[edit | edit source]
- 1
61
121
181ATGGAAAAGTCAAATAAAGAATTAGCATCTGAATTAGTAATAGCTATGTTAGAACATAAT
GCTAAACTCACTAAGTCAGGTGTAAATGGCAATCCTATTAGTTCAAGCTCCATAATTAAT
GGAGAAGTTATTGTAAATAATCTTAAATACATCAAAGATTATTTAGATCGCATGGATGAT
TAG60
120
180
183
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: EGJ38_000812 [new locus tag: EGJ38_RS04055 ]
- symbol: EGJ38_000812
- description: hypothetical protein
- length: 60
- theoretical pI: 4.93178
- theoretical MW: 6651.54
- GRAVY: -0.351667
⊟Function[edit | edit source]
- TIGRFAM:
- TheSEED:
- PFAM:
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
⊟Localization[edit | edit source]
- PSORTb: Cytoplasmic
- Cytoplasmic Score: 7.5
- Cytoplasmic Membrane Score: 1.15
- Cellwall Score: 0.62
- Extracellular Score: 0.73
- Internal Helices: 0
- DeepLocPro: Cytoplasmic
- Cytoplasmic Score: 0.7291
- Cytoplasmic Membrane Score: 0.0026
- Cell wall & surface Score: 0.0024
- Extracellular Score: 0.2659
- LocateP:
- SignalP: no predicted signal peptide
- SP(Sec/SPI): 0.02944
- TAT(Tat/SPI): 0.00156
- LIPO(Sec/SPII): 0.006397
- predicted transmembrane helices (TMHMM): 0
⊟Accession numbers[edit | edit source]
- GI:
- RefSeq: MGT2422787 NCBI
- UniProt:
⊟Protein sequence[edit | edit source]
- MEKSNKELASELVIAMLEHNAKLTKSGVNGNPISSSSIINGEVIVNNLKYIKDYLDRMDD
⊟Experimental data[edit | edit source]
- experimentally validated:
- protein localization:
- quantitative data / protein copy number per cell:
- interaction partners:
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
⊟Regulation[edit | edit source]
- regulator:
⊟Transcription pattern[edit | edit source]
- S.aureus Expression Data Browser: no data available
⊟Protein synthesis (provided by Aureolib)[edit | edit source]
- Aureolib: no data available
⊟Protein stability[edit | edit source]
- half-life: no data available
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Other Information[edit | edit source]
You can add further information about the gene and protein here. [edit]