From AureoWiki
Jump to navigation Jump to search
PangenomeCOLN315NCTC8325NewmanUSA300_FPR3757JSNZ04-0298108BA0217611819-97685071193ECT-R 2ED133ED98HO 5096 0412JH1JH9JKD6008JKD6159LGA251M013MRSA252MSHR1132MSSA476MW2Mu3Mu50RF122ST398T0131TCH60TW20USA300_TCH1516VC40

NCBI: 01-DEC-2025

Summary[edit | edit source]

  • organism: Staphylococcus aureus JSNZ
  • locus tag: EGJ38_000813 [new locus tag: EGJ38_RS04060 ]
  • pan locus tag?: SAUPAN001463000
  • symbol: EGJ38_000813
  • pan gene symbol?:
  • synonym:
  • alternate name: JSNZ_000813
  • product: helix-turn-helix transcriptional regulator

Genome View[edit | edit source]

Gene[edit | edit source]

General[edit | edit source]

  • type: CDS
  • locus tag: EGJ38_000813 [new locus tag: EGJ38_RS04060 ]
  • symbol: EGJ38_000813
  • product: helix-turn-helix transcriptional regulator
  • replicon: chromosome
  • strand: +
  • coordinates: 840921..841106
  • length: 186
  • essential: unknown

Accession numbers[edit | edit source]

  • Gene ID:
  • RefSeq: MGT2422788 NCBI
  • BioCyc:
  • MicrobesOnline:

Phenotype[edit | edit source]

Share your knowledge and add information here. [edit]

DNA sequence[edit | edit source]

  • 1
    61
    121
    181
    ATGCTGAACTTAAAAGAATTGAGAGAAGAAAAGGGGATAACACGCTATCAACTAGCGAAG
    CTAACAGAATTACAAAATTCGACAATTCGATCTATCGAAACAGAAGTTAAAAATCCCGGC
    TTCCTCACAGTAAAAAAAATATGCGATGCACTACAAGTTGATATCGCTAATGTAAAGGAG
    AAATAA
    60
    120
    180
    186

Protein[edit | edit source]

General[edit | edit source]

  • locus tag: EGJ38_000813 [new locus tag: EGJ38_RS04060 ]
  • symbol: EGJ38_000813
  • description: helix-turn-helix transcriptional regulator
  • length: 61
  • theoretical pI: 9.24218
  • theoretical MW: 7003.14
  • GRAVY: -0.445902

Function[edit | edit source]

  • TIGRFAM:
    Signal transduction Regulatory functions DNA interactions transcriptional regulator, y4mF family (TIGR03070; HMM-score: 26.3)
    and 2 more
    Hypothetical proteins Conserved TIGR00270 family protein (TIGR00270; HMM-score: 17.3)
    Genetic information processing Mobile and extrachromosomal element functions Other probable addiction module antidote protein (TIGR02684; HMM-score: 12.8)
  • TheSEED:
  • PFAM:
    HTH (CL0123) HTH_3; Helix-turn-helix (PF01381; HMM-score: 48.6)
    HTH_26; Cro/C1-type HTH DNA-binding domain (PF13443; HMM-score: 41.9)
    and 6 more
    HTH_19; Helix-turn-helix domain (PF12844; HMM-score: 32.2)
    HTH_31; Helix-turn-helix domain (PF13560; HMM-score: 32.2)
    HTH_25; Helix-turn-helix domain (PF13413; HMM-score: 24.4)
    E-set (CL0159) Ig-like_Pom152_1; Nucleoporin pom152-like, first immunoglobulin-like domain (PF24519; HMM-score: 16.3)
    HTH (CL0123) HTH_11; HTH domain (PF08279; HMM-score: 14)
    HTH_Mga; M protein trans-acting positive regulator (MGA) HTH domain (PF08280; HMM-score: 13.6)

Structure, modifications & cofactors[edit | edit source]

  • domains:
  • modifications:
  • cofactors:
  • effectors:

Localization[edit | edit source]

  • PSORTb: Cytoplasmic
    • Cytoplasmic Score: 7.5
    • Cytoplasmic Membrane Score: 1.15
    • Cellwall Score: 0.62
    • Extracellular Score: 0.73
    • Internal Helices: 0
  • DeepLocPro: Cytoplasmic
    • Cytoplasmic Score: 0.8986
    • Cytoplasmic Membrane Score: 0.0042
    • Cell wall & surface Score: 0.0011
    • Extracellular Score: 0.0961
  • LocateP:
  • SignalP: no predicted signal peptide
    • SP(Sec/SPI): 0.00598
    • TAT(Tat/SPI): 0.000406
    • LIPO(Sec/SPII): 0.00074
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit | edit source]

  • GI:
  • RefSeq: MGT2422788 NCBI
  • UniProt:

Protein sequence[edit | edit source]

  • MLNLKELREEKGITRYQLAKLTELQNSTIRSIETEVKNPGFLTVKKICDALQVDIANVKEK

Experimental data[edit | edit source]

  • experimentally validated:
  • protein localization:
  • quantitative data / protein copy number per cell:
  • interaction partners:

Expression & Regulation[edit | edit source]

Regulation[edit | edit source]

  • regulator:

Transcription pattern[edit | edit source]

Protein synthesis (provided by Aureolib)[edit | edit source]

Protein stability[edit | edit source]

  • half-life: no data available

Biological Material[edit | edit source]

Mutants[edit | edit source]

Expression vector[edit | edit source]

lacZ fusion[edit | edit source]

GFP fusion[edit | edit source]

two-hybrid system[edit | edit source]

FLAG-tag construct[edit | edit source]

Antibody[edit | edit source]

Other Information[edit | edit source]

You can add further information about the gene and protein here. [edit]

Literature[edit | edit source]

References[edit | edit source]

  1. Blanca Taboada, Karel Estrada, Ricardo Ciria, Enrique Merino
    Operon-mapper: a web server for precise operon identification in bacterial and archaeal genomes.
    Bioinformatics: 2018, 34(23);4118-4120
    [PubMed:29931111] [WorldCat.org] [DOI] (I p)

Relevant publications[edit | edit source]