From AureoWiki
Jump to: navigation, search
Pangenome04-0298108BA0217611819-9771193COLECT-R 2ED133ED98HO 5096 0412JH1JH9JKD6008JKD6159LGA251M013MRSA252MSHR1132MSSA476MW2Mu3Mu50N315NCTC8325NewmanRF122ST398T0131TCH60TW20USA300_FPR3757USA300_TCH1516VC40
NCBI: 06-JUL-2013

Summary[edit source | edit]

  • organism: Staphylococcus aureus Newman
  • locus tag: NWMN_0037 [new locus tag: NWMN_RS00225 ]
  • pan locus tag?: SAUPAN000670000
  • symbol: NWMN_0037
  • pan gene symbol?:
  • synonym:
  • product: hypothetical protein

Genome View[edit source | edit]

Gene[edit source | edit]

General[edit source | edit]

  • type: CDS
  • locus tag: NWMN_0037 [new locus tag: NWMN_RS00225 ]
  • symbol: NWMN_0037
  • product: hypothetical protein
  • replicon: chromosome
  • strand: +
  • coordinates: 48312..49055
  • length: 744
  • essential: unknown other strains

Accession numbers[edit source | edit]

Phenotype[edit source | edit]

  • Share your knowledge and add information here. [edit]

DNA sequence[edit source | edit]

  • 1
    61
    121
    181
    241
    301
    361
    421
    481
    541
    601
    661
    721
    GTGATTAAATTGAACTTTAATGATTTGGAAATTTTTATAACTGTATGTGAAGAAGCATCT
    ATCAATAAAGCTGCAATTAAACTTAGATATGCACAATCTAATATATCTCAAAGAATTAGC
    AAGCTTGAAAATGAATTAGGTGTAGTTTTGCTTTTTAGAAATCAAAAAGGTGCTAAGGCA
    ACTAAAGCAGGCGAAGAATTCTTAGCGTATAGCAAAAAAGTATTAAGAGATACAGAGACT
    ATAAAAAATAAAATGAAAAATAATACTATGTCTATTTTATGCTCAGAACTGTTATTTAAT
    TATTTATCTGAGAGCGAAGAAATTATGATGTCGAATAACTCAATTAATTTTATTTCTAGT
    GGAAATATTAGAAAAGCTATAGAAAAAAATAATTATGATAAGGTTATTTCATTCATAAAA
    ATTAACGACTCAAATTATAGACTTAGTAATGTTGATACTATGAAAGTAACGCTTTACAGT
    AATGGAAGTAATTATGATAAAGAGGCTTTACTAATAAATAAAGATGAGTTTTGTCCTTTA
    AGGAAAATAACTTTAGATAATAAGCTTGATTCACAACGGGTAATGGAAATTGATTCATTG
    GCAGCAATAATAAACTTAGTTAAACAAGGAAAAGGAAAGGCTTTATTACCTATGACTTTT
    GAGAATAAAAGAGATATAGTACAGGACATTTCTAAGATATTTGAAGTTAACTACTATACT
    TATAATCATATTATGCATCATTAA
    60
    120
    180
    240
    300
    360
    420
    480
    540
    600
    660
    720
    744

Protein[edit source | edit]

General[edit source | edit]

  • locus tag: NWMN_0037 [new locus tag: NWMN_RS00225 ]
  • symbol: NWMN_0037
  • description: hypothetical protein
  • length: 247
  • theoretical pI: 9.18932
  • theoretical MW: 28421.6
  • GRAVY: -0.3417

Function[edit source | edit]

  • reaction:
  • TIGRFAM:
    Cellular processesCellular processesToxin production and resistancetranscriptional regulator, ArgP family (TIGR03298; HMM-score: 50.2)
    Genetic information processingDNA metabolismDNA replication, recombination, and repairtranscriptional regulator, ArgP family (TIGR03298; HMM-score: 50.2)
    Signal transductionRegulatory functionsDNA interactionstranscriptional regulator, ArgP family (TIGR03298; HMM-score: 50.2)
    MetabolismEnergy metabolismOtherpca operon transcription factor PcaQ (TIGR02424; HMM-score: 44.2)
    Signal transductionRegulatory functionsDNA interactionspca operon transcription factor PcaQ (TIGR02424; HMM-score: 44.2)
    putative choline sulfate-utilization transcription factor (TIGR03418; HMM-score: 43.2)
    Signal transductionRegulatory functionsDNA interactionsaminoethylphosphonate catabolism associated LysR family transcriptional regulator (TIGR03339; HMM-score: 41.7)
    Signal transductionRegulatory functionsDNA interactionsD-serine deaminase transcriptional activator (TIGR02036; HMM-score: 25.9)
  • TheSEED:  
    LysR-family regulatory protein 
  • PFAM:
    HTH (CL0123) HTH_1; Bacterial regulatory helix-turn-helix protein, lysR family (PF00126; HMM-score: 59.6)
    PBP (CL0177) LysR_substrate; LysR substrate binding domain (PF03466; HMM-score: 14.9)
    HAD (CL0137) PNK3P; Polynucleotide kinase 3 phosphatase (PF08645; HMM-score: 14.6)
    no clan definedImm43; Immunity protein 43 (PF15570; HMM-score: 9.6)

Structure, modifications & interactions[edit source | edit]

  • domains:
  • modifications:
  • cofactors:
  • effectors:
  • protein partners:

Localization[edit source | edit]

  • PSORTb: Cytoplasmic
    • Cytoplasmic Score: 9.97
    • Cytoplasmic Membrane Score: 0
    • Cellwall Score: 0.01
    • Extracellular Score: 0.02
    • Internal Helices: 0
  • LocateP: Intracellular
    • Prediction by SwissProt Classification: Cytoplasmic
    • Pathway Prediction: No pathway
    • Intracellular Possibility: 1
    • Signal Peptide Possibility: -1
    • N-terminally Anchored Score: 1
    • Predicted Cleavage Site: No CleavageSite
  • SignalP: no predicted signal peptide
    • Ymax: 0.159
    • Ymax_pos: 25
    • Cmax: 0.176
    • Cmax_pos: 25
    • Smax: 0.191
    • Smax_pos: 24
    • Smean: 0.137
    • D: 0.151
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit source | edit]

Protein sequence[edit source | edit]

  • MIKLNFNDLEIFITVCEEASINKAAIKLRYAQSNISQRISKLENELGVVLLFRNQKGAKATKAGEEFLAYSKKVLRDTETIKNKMKNNTMSILCSELLFNYLSESEEIMMSNNSINFISSGNIRKAIEKNNYDKVISFIKINDSNYRLSNVDTMKVTLYSNGSNYDKEALLINKDEFCPLRKITLDNKLDSQRVMEIDSLAAIINLVKQGKGKALLPMTFENKRDIVQDISKIFEVNYYTYNHIMHH

Experimental data[edit source | edit]

  • experimentally validated: no data available

Expression & Regulation[edit source | edit]

Operon[edit source | edit]

Regulation[edit source | edit]

  • sigma factor:
  • regulator:

Transcription pattern[edit source | edit]

Protein synthesis (provided by Aureolib)[edit source | edit]

Protein stability[edit source | edit]

  • half-life: no data available

Biological Material[edit source | edit]

Mutants[edit source | edit]

Expression vector[edit source | edit]

lacZ fusion[edit source | edit]

GFP fusion[edit source | edit]

two-hybrid system[edit source | edit]

FLAG-tag construct[edit source | edit]

Antibody[edit source | edit]

Other Information[edit source | edit]

You are kindly invited to share additional interesting facts.

Literature[edit source | edit]

References[edit source | edit]

Relevant publications[edit source | edit]