From AureoWiki
Jump to: navigation, search
Pangenome04-0298108BA0217611819-9771193COLECT-R 2ED133ED98HO 5096 0412JH1JH9JKD6008JKD6159LGA251M013MRSA252MSHR1132MSSA476MW2Mu3Mu50N315NCTC8325NewmanRF122ST398T0131TCH60TW20USA300_FPR3757USA300_TCH1516VC40

NCBI: 06-JUL-2013

Summary[edit source | edit]

  • organism: Staphylococcus aureus Newman
  • locus tag: NWMN_0286 [new locus tag: NWMN_RS01635 ]
  • pan locus tag?: SAUPAN000558000
  • symbol: NWMN_0286
  • pan gene symbol?:
  • synonym:
  • product: hypothetical protein

Genome View[edit source | edit]

Gene[edit source | edit]

General[edit source | edit]

  • type: CDS
  • locus tag: NWMN_0286 [new locus tag: NWMN_RS01635 ]
  • symbol: NWMN_0286
  • product: hypothetical protein
  • replicon: chromosome
  • strand: +
  • coordinates: 336774..337160
  • length: 387
  • essential: unknown

Accession numbers[edit source | edit]

Phenotype[edit source | edit]

Share your knowledge and add information here. [edit]

DNA sequence[edit source | edit]

  • 1
    61
    121
    181
    241
    301
    361
    ATGATTAAAAAACTTAAAAATATGGATTGGTTCGATATCTTTATTGCTGGAATACTGCGA
    TTATTCGGCGTAATCGCACTGATGCTTGTTGTCATATCGCCTATATACACAGTGGCTAGT
    TACCAACACAAAGAAGTACATCAAGGGACAATTACAGATAAATATAACAAGAGACAAGAT
    AAAGAAGACAAGTTCTATATTGTATTAGACAACAAACAAGTCATTGAAAATTCTGATTTA
    TTATTCAAAAAGAAATTTGATAGCGCAGACATACAAGCTAGGTTAAAAGTAGGCGATAAA
    GTAAAAGTTAAGACGATTGGATATAGAATACACTTTTTAAATTTATATCCGATCTTATAC
    GAAGTAAAGAAGGTAGATAAAAAATGA
    60
    120
    180
    240
    300
    360
    387

Protein[edit source | edit]

General[edit source | edit]

  • locus tag: NWMN_0286 [new locus tag: NWMN_RS01635 ]
  • symbol: NWMN_0286
  • description: hypothetical protein
  • length: 128
  • theoretical pI: 10.2077
  • theoretical MW: 15082.8
  • GRAVY: -0.164062

Function[edit source | edit]

  • reaction:
  • TIGRFAM:
  • TheSEED:  
    Hypothetical protein, SAV0881 homolog [SA bacteriophages 11, Mu50B] 
  • PFAM:
    no clan definedDUF1523; Protein of unknown function (DUF1523) (PF07509; HMM-score: 27.3)
    DUF3592; Protein of unknown function (DUF3592) (PF12158; HMM-score: 12.2)

Structure, modifications & interactions[edit source | edit]

  • domains:
  • modifications:
  • cofactors:
  • effectors:
  • protein partners:

Localization[edit source | edit]

  • PSORTb: Cytoplasmic Membrane
    • Cytoplasmic Score: 0.32
    • Cytoplasmic Membrane Score: 9.55
    • Cellwall Score: 0.12
    • Extracellular Score: 0.01
    • Internal Helix: 1
  • LocateP: N-terminally anchored (No CS)
    • Prediction by SwissProt Classification: Membrane
    • Pathway Prediction: Sec-(SPI)
    • Intracellular Possibility: 0.17
    • Signal Peptide Possibility: -0.5
    • N-terminally Anchored Score: 2
    • Predicted Cleavage Site: No CleavageSite
  • SignalP: no predicted signal peptide
    • Ymax: 0.265
    • Ymax_pos: 42
    • Cmax: 0.207
    • Cmax_pos: 42
    • Smax: 0.538
    • Smax_pos: 38
    • Smean: 0.174
    • D: 0.23
  • predicted transmembrane helices (TMHMM): 1

Accession numbers[edit source | edit]

Protein sequence[edit source | edit]

  • MIKKLKNMDWFDIFIAGILRLFGVIALMLVVISPIYTVASYQHKEVHQGTITDKYNKRQDKEDKFYIVLDNKQVIENSDLLFKKKFDSADIQARLKVGDKVKVKTIGYRIHFLNLYPILYEVKKVDKK

Experimental data[edit source | edit]

  • experimentally validated: no data available

Expression & Regulation[edit source | edit]

Operon[edit source | edit]

Regulation[edit source | edit]

  • sigma factor:
  • regulator:

Transcription pattern[edit source | edit]

Protein synthesis (provided by Aureolib)[edit source | edit]

Protein stability[edit source | edit]

  • half-life: no data available

Biological Material[edit source | edit]

Mutants[edit source | edit]

Expression vector[edit source | edit]

lacZ fusion[edit source | edit]

GFP fusion[edit source | edit]

two-hybrid system[edit source | edit]

FLAG-tag construct[edit source | edit]

Antibody[edit source | edit]

Other Information[edit source | edit]

You are kindly invited to share additional interesting facts.

Literature[edit source | edit]

References[edit source | edit]

Relevant publications[edit source | edit]