From AureoWiki
Jump to: navigation, search
Pangenome04-0298108BA0217611819-9771193COLECT-R 2ED133ED98HO 5096 0412JH1JH9JKD6008JKD6159LGA251M013MRSA252MSHR1132MSSA476MW2Mu3Mu50N315NCTC8325NewmanRF122ST398T0131TCH60TW20USA300_FPR3757USA300_TCH1516VC40
NCBI: 06-JUL-2013

Summary[edit source | edit]

  • organism: Staphylococcus aureus Newman
  • locus tag: NWMN_0393 [new locus tag: NWMN_RS02225 ]
  • pan locus tag?: SAUPAN002112000
  • symbol: set6nm
  • pan gene symbol?: ssl6
  • synonym:
  • product: superantigen-like protein

Genome View[edit source | edit]

Gene[edit source | edit]

General[edit source | edit]

  • type: CDS
  • locus tag: NWMN_0393 [new locus tag: NWMN_RS02225 ]
  • symbol: set6nm
  • product: superantigen-like protein
  • replicon: chromosome
  • strand: +
  • coordinates: 441847..442542
  • length: 696
  • essential: unknown other strains

Accession numbers[edit source | edit]

Phenotype[edit source | edit]

  • Share your knowledge and add information here. [edit]

DNA sequence[edit source | edit]

  • 1
    61
    121
    181
    241
    301
    361
    421
    481
    541
    601
    661
    ATGAAATTAAAAACGTTAGCTAAAGCAACATTAGTATTGGGATTGTTAGCTACTGGTGTA
    ATAACAACAGAAAGTCAAACAGTAAAAGCGGCAGAATCAACTCAAGGTCAACACAATTAT
    AAATCGTTAAAATACTACTATAGCAAGCCAAGTATAGAGTTAAAAAATCTTGATGGTTTG
    TATAGACAGAAAGTGACAGATAAAGGAGTATATGTTTGGAAGGATCGAAAAGATTATTTT
    GTTGGCTTGCTTGGTAAAGATATTGAAAAATACCCTCAAGGTGAGCATGATAAGCAAGAT
    GCATTTTTAGTCATCGAGGAGGAAACTGTTAATGGAAGACAATATTCAATTGGTGGTTTA
    AGTAAGACAAATAGTAAAGAATTTAGTAAAGAAGTCGATGTTAAAGTAACAAGAAAAATT
    GATGAATCATCGGAAAAGTCTAAAGATAGTAAATTTAAAATTACTAAAGAAGAAATCTCG
    TTAAAAGAGTTGGACTTTAAATTAAGAAAAAAATTGATGGAAGAAGAAAAATTATATGGT
    GCTGTTAATAATAGAAAAGGTAAAATTGTAGTTAAAATGGAAGATGATAAGTTTTATACT
    TTCGAACTTACAAAAAAACTACAACCGCATCGCATGGGTGACACGATAGATGGTACCAAA
    ATCAAAGAAATTAATGTTGAGCTAGAATATAAATAA
    60
    120
    180
    240
    300
    360
    420
    480
    540
    600
    660
    696

Protein[edit source | edit]

Protein Data Bank: 3V05
Protein Data Bank: 4RFB
Protein Data Bank: 4RGT

General[edit source | edit]

  • locus tag: NWMN_0393 [new locus tag: NWMN_RS02225 ]
  • symbol: Set6nm
  • description: superantigen-like protein
  • length: 231
  • theoretical pI: 9.76225
  • theoretical MW: 26655.4
  • GRAVY: -0.795671

Function[edit source | edit]

  • reaction:
  • TIGRFAM:
  • TheSEED:  
    exotoxin homolog [Genomic island nu Sa alpha2] 
  • PFAM:
    OB_enterotoxin (CL0658) SSL_OB; Staphylococcal superantigen-like OB-fold domain (PF09199; HMM-score: 103.6)
    Ant-toxin_C (CL0386) Stap_Strp_tox_C; Staphylococcal/Streptococcal toxin, beta-grasp domain (PF02876; HMM-score: 31.1)

Structure, modifications & interactions[edit source | edit]

  • domains:
  • modifications:
  • cofactors:
  • effectors:
  • protein partners:

Localization[edit source | edit]

  • PSORTb: Extracellular
    • Cytoplasmic Score: 0
    • Cytoplasmic Membrane Score: 0
    • Cellwall Score: 0
    • Extracellular Score: 10
    • Internal Helices: 0
  • LocateP: Secretory(released) (with CS)
    • Prediction by SwissProt Classification: Extracellular
    • Pathway Prediction: Sec-(SPI)
    • Intracellular Possibility: -0.17
    • Signal Peptide Possibility: 1
    • N-terminally Anchored Score: -2
    • Predicted Cleavage Site: QTVKAAES
  • SignalP: Signal peptide length 31 aa
    • Ymax: 0.829
    • Ymax_pos: 31
    • Cmax: 0.843
    • Cmax_pos: 31
    • Smax: 0.905
    • Smax_pos: 2
    • Smean: 0.854
    • D: 0.839
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit source | edit]

Protein sequence[edit source | edit]

  • MKLKTLAKATLVLGLLATGVITTESQTVKAAESTQGQHNYKSLKYYYSKPSIELKNLDGLYRQKVTDKGVYVWKDRKDYFVGLLGKDIEKYPQGEHDKQDAFLVIEEETVNGRQYSIGGLSKTNSKEFSKEVDVKVTRKIDESSEKSKDSKFKITKEEISLKELDFKLRKKLMEEEKLYGAVNNRKGKIVVKMEDDKFYTFELTKKLQPHRMGDTIDGTKIKEINVELEYK

Experimental data[edit source | edit]

  • experimentally validated: no data available

Expression & Regulation[edit source | edit]

Operon[edit source | edit]

Regulation[edit source | edit]

  • sigma factor:
  • regulator:

Transcription pattern[edit source | edit]

Protein synthesis (provided by Aureolib)[edit source | edit]

Protein stability[edit source | edit]

  • half-life: no data available

Biological Material[edit source | edit]

Mutants[edit source | edit]

Expression vector[edit source | edit]

lacZ fusion[edit source | edit]

GFP fusion[edit source | edit]

two-hybrid system[edit source | edit]

FLAG-tag construct[edit source | edit]

Antibody[edit source | edit]

Other Information[edit source | edit]

You are kindly invited to share additional interesting facts.

Literature[edit source | edit]

References[edit source | edit]

Relevant publications[edit source | edit]

Stefan Monecke, Peter Slickers, Ralf Ehricht
Assignment of Staphylococcus aureus isolates to clonal complexes based on microarray analysis and pattern recognition.
FEMS Immunol. Med. Microbiol.: 2008, 53(2);237-51
[PubMed:18507678] [WorldCat.org] [DOI] (P p)