From AureoWiki
Jump to: navigation, search
Pangenome04-0298108BA0217611819-9771193COLECT-R 2ED133ED98HO 5096 0412JH1JH9JKD6008JKD6159LGA251M013MRSA252MSHR1132MSSA476MW2Mu3Mu50N315NCTC8325NewmanRF122ST398T0131TCH60TW20USA300_FPR3757USA300_TCH1516VC40
NCBI: 06-JUL-2013

Summary[edit source | edit]

  • organism: Staphylococcus aureus Newman
  • locus tag: NWMN_0751
  • pan locus tag?: SAUPAN002769000
  • symbol: NWMN_0751
  • pan gene symbol?:
  • synonym:
  • product: hypothetical protein

Genome View[edit source | edit]

Gene[edit source | edit]

General[edit source | edit]

  • type: CDS
  • locus tag: NWMN_0751
  • symbol: NWMN_0751
  • product: hypothetical protein
  • replicon: chromosome
  • strand: -
  • coordinates: 845805..845999
  • length: 195
  • essential: unknown

Accession numbers[edit source | edit]

Phenotype[edit source | edit]

  • Share your knowledge and add information here. [edit]

DNA sequence[edit source | edit]

  • 1
    61
    121
    181
    TTGCAAATTATAAAAACTAAAAATTCCAAAAAGAGTTTATCATCCAAAACAATAAAAATG
    GCTACAATGGTATGTTGTGAAATGCATTTCTTAACTACGACTTCTTTTATTTCCGTCTCG
    TCAACTATTGCTGATTGTGTTAATAGGCATATTGATTCTAATGAAAATATCAAAACTCGG
    CTCATCTCTTTATAA
    60
    120
    180
    195

Protein[edit source | edit]

General[edit source | edit]

  • locus tag: NWMN_0751
  • symbol: NWMN_0751
  • description: hypothetical protein
  • length: 64
  • theoretical pI: 10.0723
  • theoretical MW: 7180.46
  • GRAVY: 0.0046875

Function[edit source | edit]

  • reaction:
  • TIGRFAM:
  • TheSEED:
  • PFAM:
    no clan definedzf-Tim10_DDP; Tim10/DDP family zinc finger (PF02953; HMM-score: 14.4)
    UPF0228; Uncharacterised protein family (UPF0228) (PF05727; HMM-score: 12.9)

Structure, modifications & interactions[edit source | edit]

  • domains:
  • modifications:
  • cofactors:
  • effectors:
  • protein partners:

Localization[edit source | edit]

  • PSORTb: unknown (no significant prediction)
    • Cytoplasmic Score: 2.5
    • Cytoplasmic Membrane Score: 2.5
    • Cellwall Score: 2.5
    • Extracellular Score: 2.5
    • Internal Helices: 0
  • LocateP: N-terminally anchored (No CS)
    • Prediction by SwissProt Classification: Membrane
    • Pathway Prediction: Sec-(SPI)
    • Intracellular Possibility: 0.5
    • Signal Peptide Possibility: 0
    • N-terminally Anchored Score: 4
    • Predicted Cleavage Site: No CleavageSite
  • SignalP: Signal peptide length 21 aa
    • Ymax: 0.3
    • Ymax_pos: 21
    • Cmax: 0.155
    • Cmax_pos: 47
    • Smax: 0.9
    • Smax_pos: 7
    • Smean: 0.747
    • D: 0.475
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit source | edit]

Protein sequence[edit source | edit]

  • MQIIKTKNSKKSLSSKTIKMATMVCCEMHFLTTTSFISVSSTIADCVNRHIDSNENIKTRLISL

Experimental data[edit source | edit]

  • experimentally validated: no data available

Expression & Regulation[edit source | edit]

Operon[edit source | edit]

Regulation[edit source | edit]

  • sigma factor:
  • regulator:

Transcription pattern[edit source | edit]

Protein synthesis (provided by Aureolib)[edit source | edit]

Protein stability[edit source | edit]

  • half-life: no data available

Biological Material[edit source | edit]

Mutants[edit source | edit]

Expression vector[edit source | edit]

lacZ fusion[edit source | edit]

GFP fusion[edit source | edit]

two-hybrid system[edit source | edit]

FLAG-tag construct[edit source | edit]

Antibody[edit source | edit]

Other Information[edit source | edit]

You are kindly invited to share additional interesting facts.

Literature[edit source | edit]

References[edit source | edit]

Relevant publications[edit source | edit]