From AureoWiki
Jump to: navigation, search
Pangenome04-0298108BA0217611819-9771193COLECT-R 2ED133ED98HO 5096 0412JH1JH9JKD6008JKD6159LGA251M013MRSA252MSHR1132MSSA476MW2Mu3Mu50N315NCTC8325NewmanRF122ST398T0131TCH60TW20USA300_FPR3757USA300_TCH1516VC40
NCBI: 06-JUL-2013

Summary[edit source | edit]

  • organism: Staphylococcus aureus Newman
  • locus tag: NWMN_0999 [new locus tag: NWMN_RS05625 ]
  • pan locus tag?: SAUPAN001671000
  • symbol: NWMN_0999
  • pan gene symbol?:
  • synonym:
  • product: hypothetical protein

Genome View[edit source | edit]

Gene[edit source | edit]

General[edit source | edit]

  • type: CDS
  • locus tag: NWMN_0999 [new locus tag: NWMN_RS05625 ]
  • symbol: NWMN_0999
  • product: hypothetical protein
  • replicon: chromosome
  • strand: +
  • coordinates: 1105554..1106327
  • length: 774
  • essential: unknown

Accession numbers[edit source | edit]

Phenotype[edit source | edit]

  • Share your knowledge and add information here. [edit]

DNA sequence[edit source | edit]

  • 1
    61
    121
    181
    241
    301
    361
    421
    481
    541
    601
    661
    721
    ATGAGTGAGGAACAAGACATTTTACAAGAACTAGGTATTGAAGAAATTAACGAAGATACT
    CAGAACTATTATTCAATTATGGTATATGGCAAATCAGGAACCGGAAAGACGACTTTAGCC
    ACTAGAGAAAACAACGCTTTTATTATTGATATTCACGAAGATGGCACTCAAGTAACGCGG
    CAAGGTTTTGTGAAGAGGGTCGACAATTACATTGCTTTTAGAAACACAATTGCGAGTATT
    GAATCGATTGTAAATACAGCTAGACAAAGAGGAAAGTTACTTGATGTGGTTGTAATTGAA
    ACAGCACAAAAGTTAAGAGATATAACGCTGACTCATGTGATGAACACGCACCAAGTCAAA
    AAAGCAAGAATTCAAGATTATGGGGAAACATCTAAATTAATTGTTAACTCGATTAGGCAC
    CTATTAAAGGTTAAAGATAAGCTCGGATTTCACGTTGTGCTTACAGGACATGAAGGGCTT
    AACTCAGAAGATAAAGATGAGAACGGAAAAATTATTAACCCTAGAATATCAATTGAAGTA
    CAACCGGCAATACACAACAACTTAGTAACTCAGTTCGACATTATAGGACACACATTTATA
    GAAGATCATACAGATGAGAACGGAAATGCGACACACGATTATGTGTTTTCTGTAGAACCT
    TCTAATTTATATACAACTAAAGTTAGGCATAATCCGCAAATAACAATCAATAATCCAGGT
    ATTAAAAATGCTTCAATTTCAAAAATTATAGATATGGCACAAAACGGAAACTAA
    60
    120
    180
    240
    300
    360
    420
    480
    540
    600
    660
    720
    774

Protein[edit source | edit]

General[edit source | edit]

  • locus tag: NWMN_0999 [new locus tag: NWMN_RS05625 ]
  • symbol: NWMN_0999
  • description: hypothetical protein
  • length: 257
  • theoretical pI: 6.2869
  • theoretical MW: 28960.3
  • GRAVY: -0.477043

Function[edit source | edit]

  • reaction:
  • TIGRFAM:
    Genetic information processingMobile and extrachromosomal element functionsProphage functionsphage nucleotide-binding protein (TIGR01618; HMM-score: 37.8)
    surface protein repeat SSSPR-51 (TIGR04308; HMM-score: 19.2)
  • TheSEED:  
    Hypothetical protein, phi-ETA orf17 homolog [SA bacteriophages 11, Mu50B] 
  • PFAM:
    P-loop_NTPase (CL0023) AAA_24; AAA domain (PF13479; HMM-score: 85.6)
    RuvB_N; Holliday junction DNA helicase ruvB N-terminus (PF05496; HMM-score: 20)
    AAA_22; AAA domain (PF13401; HMM-score: 19.1)
    PEP-carboxyk (CL0374) PEPCK_ATP; Phosphoenolpyruvate carboxykinase (PF01293; HMM-score: 17.9)
    P-loop_NTPase (CL0023) AAA_16; AAA ATPase domain (PF13191; HMM-score: 16.6)
    AAA_25; AAA domain (PF13481; HMM-score: 14.5)
    AAA_33; AAA domain (PF13671; HMM-score: 14.3)
    AAA_18; AAA domain (PF13238; HMM-score: 14.2)
    AAA; ATPase family associated with various cellular activities (AAA) (PF00004; HMM-score: 13.9)
    NB-ARC; NB-ARC domain (PF00931; HMM-score: 13.7)
    RNA_helicase; RNA helicase (PF00910; HMM-score: 13.5)
    Sigma54_activat; Sigma-54 interaction domain (PF00158; HMM-score: 13.3)
    ATPase_2; ATPase domain predominantly from Archaea (PF01637; HMM-score: 12.3)
    DUF2075; Uncharacterized conserved protein (DUF2075) (PF09848; HMM-score: 10.6)
    CbiA; CobQ/CobB/MinD/ParA nucleotide binding domain (PF01656; HMM-score: 10)

Structure, modifications & interactions[edit source | edit]

  • domains:
  • modifications:
  • cofactors:
  • effectors:
  • protein partners:

Localization[edit source | edit]

  • PSORTb: Cytoplasmic
    • Cytoplasmic Score: 7.5
    • Cytoplasmic Membrane Score: 1.15
    • Cellwall Score: 0.62
    • Extracellular Score: 0.73
    • Internal Helices: 0
  • LocateP: Intracellular
    • Prediction by SwissProt Classification: Cytoplasmic
    • Pathway Prediction: No pathway
    • Intracellular Possibility: 1
    • Signal Peptide Possibility: -1
    • N-terminally Anchored Score: 1
    • Predicted Cleavage Site: No CleavageSite
  • SignalP: no predicted signal peptide
    • Ymax: 0.114
    • Ymax_pos: 41
    • Cmax: 0.118
    • Cmax_pos: 41
    • Smax: 0.223
    • Smax_pos: 39
    • Smean: 0.077
    • D: 0.1
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit source | edit]

Protein sequence[edit source | edit]

  • MSEEQDILQELGIEEINEDTQNYYSIMVYGKSGTGKTTLATRENNAFIIDIHEDGTQVTRQGFVKRVDNYIAFRNTIASIESIVNTARQRGKLLDVVVIETAQKLRDITLTHVMNTHQVKKARIQDYGETSKLIVNSIRHLLKVKDKLGFHVVLTGHEGLNSEDKDENGKIINPRISIEVQPAIHNNLVTQFDIIGHTFIEDHTDENGNATHDYVFSVEPSNLYTTKVRHNPQITINNPGIKNASISKIIDMAQNGN

Experimental data[edit source | edit]

  • experimentally validated: no data available

Expression & Regulation[edit source | edit]

Operon[edit source | edit]

Regulation[edit source | edit]

  • sigma factor:
  • regulator:

Transcription pattern[edit source | edit]

Protein synthesis (provided by Aureolib)[edit source | edit]

Protein stability[edit source | edit]

  • half-life: no data available

Biological Material[edit source | edit]

Mutants[edit source | edit]

Expression vector[edit source | edit]

lacZ fusion[edit source | edit]

GFP fusion[edit source | edit]

two-hybrid system[edit source | edit]

FLAG-tag construct[edit source | edit]

Antibody[edit source | edit]

Other Information[edit source | edit]

You are kindly invited to share additional interesting facts.

Literature[edit source | edit]

References[edit source | edit]

Relevant publications[edit source | edit]