From AureoWiki
Jump to: navigation, search
NCBI: 06-JUL-2013

Summary[edit source | edit]

  • organism: Staphylococcus aureus Newman
  • locus tag: NWMN_1849 [new locus tag: NWMN_RS10625 ]
  • pan locus tag?: SAUPAN004944000
  • symbol: NWMN_1849
  • pan gene symbol?:
  • synonym:
  • product: hypothetical protein

Genome View[edit source | edit]

Gene[edit source | edit]

General[edit source | edit]

  • type: CDS
  • locus tag: NWMN_1849 [new locus tag: NWMN_RS10625 ]
  • symbol: NWMN_1849
  • product: hypothetical protein
  • replicon: chromosome
  • strand: -
  • coordinates: 2060612..2061214
  • length: 603
  • essential: unknown other strains

Accession numbers[edit source | edit]

Phenotype[edit source | edit]

  • Share your knowledge and add information here. [edit]

DNA sequence[edit source | edit]

  • 1
    61
    121
    181
    241
    301
    361
    421
    481
    541
    601
    ATGTCATTCGTAACAGAAAATCCATGGTTAATGGTACTAACTATATTTATCATTAACGTT
    TGTTATGTAACGTTTTTAACGATGCGAACAATTTTAACGTTGAAAGGTTATCGTTATATT
    GCTGCATCAGTTAGTTTTTTAGAAGTATTAGTTTATATCGTTGGTTTAGGTTTGGTTATG
    TCTAATTTAGACCATATTCAAAATATTATTGCCTACGCATTTGGTTTTTCAATAGGTATC
    ATTGTTGGTATGAAAATAGAAGAAAAACTGGCATTAGGTTATACAGTTGTAAATGTAACT
    TCAGCAGAATATGAGTTAGATTTACCGAATGAACTTCGAAATTTAGGATATGGCGTTACG
    CACTATGCTGCGTTTGGTAGAGATGGTAGTCGTATGGTGATGCAAATTTTAACACCAAGA
    AAATATGAACGTAAATTGATGGATACGATAAAAAATTTAGATCCGAAAGCATTTATCATT
    GCGTATGAACCTCGAAACATACATGGTGGATTCTGGACTAAAGGCATTCGTCGTAGAAAG
    CTTAAAGATTATGAACCAGAAGAACTGGAAAGTGTAGTAGAACATGAAATTCAAAGTAAA
    TGA
    60
    120
    180
    240
    300
    360
    420
    480
    540
    600
    603

Protein[edit source | edit]

General[edit source | edit]

  • locus tag: NWMN_1849 [new locus tag: NWMN_RS10625 ]
  • symbol: NWMN_1849
  • description: hypothetical protein
  • length: 200
  • theoretical pI: 8.36834
  • theoretical MW: 22954.8
  • GRAVY: 0.166

Function[edit source | edit]

  • reaction:
  • TIGRFAM:
  • TheSEED:  
    FIG01225759: possible membrane protein 
  • PFAM:
    GlnB-like (CL0089) DUF2179; Uncharacterized protein conserved in bacteria (DUF2179) (PF10035; HMM-score: 36.7)

Structure, modifications & interactions[edit source | edit]

  • domains:
  • modifications:
  • cofactors:
  • effectors:
  • protein partners:

Localization[edit source | edit]

  • PSORTb: Cytoplasmic Membrane
    • Cytoplasmic Score: 0.32
    • Cytoplasmic Membrane Score: 9.55
    • Cellwall Score: 0.12
    • Extracellular Score: 0.01
    • Internal Helices: 2
  • LocateP: Multi-transmembrane
    • Prediction by SwissProt Classification: Membrane
    • Pathway Prediction: Sec-(SPI)
    • Intracellular Possibility: 0.17
    • Signal Peptide Possibility: -1
    • N-terminally Anchored Score: 1
    • Predicted Cleavage Site: No CleavageSite
  • SignalP: no predicted signal peptide
    • Ymax: 0.105
    • Ymax_pos: 11
    • Cmax: 0.115
    • Cmax_pos: 42
    • Smax: 0.138
    • Smax_pos: 3
    • Smean: 0.107
    • D: 0.106
  • predicted transmembrane helices (TMHMM): 3

Accession numbers[edit source | edit]

Protein sequence[edit source | edit]

  • MSFVTENPWLMVLTIFIINVCYVTFLTMRTILTLKGYRYIAASVSFLEVLVYIVGLGLVMSNLDHIQNIIAYAFGFSIGIIVGMKIEEKLALGYTVVNVTSAEYELDLPNELRNLGYGVTHYAAFGRDGSRMVMQILTPRKYERKLMDTIKNLDPKAFIIAYEPRNIHGGFWTKGIRRRKLKDYEPEELESVVEHEIQSK

Experimental data[edit source | edit]

  • experimentally validated: no data available

Expression & Regulation[edit source | edit]

Operon[edit source | edit]

Regulation[edit source | edit]

  • sigma factor:
  • regulator:

Transcription pattern[edit source | edit]

Protein synthesis (provided by Aureolib)[edit source | edit]

Protein stability[edit source | edit]

  • half-life: no data available

Biological Material[edit source | edit]

Mutants[edit source | edit]

Expression vector[edit source | edit]

lacZ fusion[edit source | edit]

GFP fusion[edit source | edit]

two-hybrid system[edit source | edit]

FLAG-tag construct[edit source | edit]

Antibody[edit source | edit]

Other Information[edit source | edit]

You are kindly invited to share additional interesting facts.

Literature[edit source | edit]

References[edit source | edit]

Relevant publications[edit source | edit]