From AureoWiki
Jump to: navigation, search
NCBI: 06-JUL-2013

Summary[edit source | edit]

  • organism: Staphylococcus aureus Newman
  • locus tag: NWMN_2087 [new locus tag: NWMN_RS12085 ]
  • pan locus tag?: SAUPAN005579000
  • symbol: NWMN_2087
  • pan gene symbol?:
  • synonym:
  • product: hypothetical protein

Genome View[edit source | edit]

Gene[edit source | edit]

General[edit source | edit]

  • type: CDS
  • locus tag: NWMN_2087 [new locus tag: NWMN_RS12085 ]
  • symbol: NWMN_2087
  • product: hypothetical protein
  • replicon: chromosome
  • strand: -
  • coordinates: 2324400..2324639
  • length: 240
  • essential: unknown other strains

Accession numbers[edit source | edit]

Phenotype[edit source | edit]

  • Share your knowledge and add information here. [edit]

DNA sequence[edit source | edit]

  • 1
    61
    121
    181
    ATGGCTAACAATCATAACCAAAACGGACAAGACTCTACACAACAAGTGATTAATTTTTTA
    AAAGTATTTAAATGGAGAATCGTTGGTTTCCTAGCGTTTCTATTAATCGCGATATTATTC
    TTAACGTTAGGTTTTTGGAAAACAGTACTTATCATCGTTTTATGTTTAATTGGTGTAGGT
    ATTGGGTATATGAAAGACCGTAAGCAAGATTTTATGAATTTTTTAAATCGATGGAGTTAA
    60
    120
    180
    240

Protein[edit source | edit]

General[edit source | edit]

  • locus tag: NWMN_2087 [new locus tag: NWMN_RS12085 ]
  • symbol: NWMN_2087
  • description: hypothetical protein
  • length: 79
  • theoretical pI: 10.6864
  • theoretical MW: 9222.96
  • GRAVY: 0.508861

Function[edit source | edit]

  • reaction:
  • TIGRFAM:
    Genetic information processingProtein fateProtein modification and repairapolipoprotein N-acyltransferase (TIGR00546; EC 2.3.1.-; HMM-score: 15.1)
  • TheSEED:  
    Hypothetical protein SAV2183 
  • PFAM:
    no clan definedDUF2273; Small integral membrane protein (DUF2273) (PF10031; HMM-score: 49)
    TMEM82; Transmembrane protein 82 (PF15816; HMM-score: 15.4)
    DUF2207; Predicted membrane protein (DUF2207) (PF09972; HMM-score: 12.6)
    Myelin_PLP; Myelin proteolipid protein (PLP or lipophilin) (PF01275; HMM-score: 11.7)
    DUF4131; Domain of unknown function (DUF4131) (PF13567; HMM-score: 11.4)

Structure, modifications & interactions[edit source | edit]

  • domains:
  • modifications:
  • cofactors:
  • effectors:
  • protein partners:

Localization[edit source | edit]

  • PSORTb: Cytoplasmic Membrane
    • Cytoplasmic Score: 0.32
    • Cytoplasmic Membrane Score: 9.55
    • Cellwall Score: 0.12
    • Extracellular Score: 0.01
    • Internal Helices: 2
  • LocateP: Multi-transmembrane
    • Prediction by SwissProt Classification: Membrane
    • Pathway Prediction: Sec-(SPI)
    • Intracellular Possibility: 0.17
    • Signal Peptide Possibility: -1
    • N-terminally Anchored Score: 1
    • Predicted Cleavage Site: No CleavageSite
  • SignalP: no predicted signal peptide
    • Ymax: 0.108
    • Ymax_pos: 70
    • Cmax: 0.138
    • Cmax_pos: 47
    • Smax: 0.165
    • Smax_pos: 64
    • Smean: 0.075
    • D: 0.095
  • predicted transmembrane helices (TMHMM): 2

Accession numbers[edit source | edit]

Protein sequence[edit source | edit]

  • MANNHNQNGQDSTQQVINFLKVFKWRIVGFLAFLLIAILFLTLGFWKTVLIIVLCLIGVGIGYMKDRKQDFMNFLNRWS

Experimental data[edit source | edit]

  • experimentally validated: no data available

Expression & Regulation[edit source | edit]

Operon[edit source | edit]

Regulation[edit source | edit]

  • sigma factor: SigB [1] [2] other strains
    SigB (sigma factor) controls a large regulon involved in stress/starvation response and adaptation
  • regulator:

Transcription pattern[edit source | edit]

Protein synthesis (provided by Aureolib)[edit source | edit]

Protein stability[edit source | edit]

  • half-life: no data available

Biological Material[edit source | edit]

Mutants[edit source | edit]

Expression vector[edit source | edit]

lacZ fusion[edit source | edit]

GFP fusion[edit source | edit]

two-hybrid system[edit source | edit]

FLAG-tag construct[edit source | edit]

Antibody[edit source | edit]

Other Information[edit source | edit]

You are kindly invited to share additional interesting facts.

Literature[edit source | edit]

References[edit source | edit]

  1. Bettina Schulthess, Dominik A Bloes, Patrice François, Myriam Girard, Jacques Schrenzel, Markus Bischoff, Brigitte Berger-Bächi
    The σB-dependent yabJ-spoVG operon is involved in the regulation of extracellular nuclease, lipase, and protease expression in Staphylococcus aureus.
    J. Bacteriol.: 2011, 193(18);4954-62
    [PubMed:21725011] [WorldCat.org] [DOI] (I p)
  2. Markus Bischoff, Paul Dunman, Jan Kormanec, Daphne Macapagal, Ellen Murphy, William Mounts, Brigitte Berger-Bächi, Steven Projan
    Microarray-based analysis of the Staphylococcus aureus sigmaB regulon.
    J. Bacteriol.: 2004, 186(13);4085-99
    [PubMed:15205410] [WorldCat.org] [DOI] (P p)

Relevant publications[edit source | edit]