From AureoWiki
Jump to: navigation, search
NCBI: 06-JUL-2013

Summary[edit source | edit]

  • organism: Staphylococcus aureus Newman
  • locus tag: NWMN_2249 [new locus tag: NWMN_RS12950 ]
  • pan locus tag?: SAUPAN005847000
  • symbol: NWMN_2249
  • pan gene symbol?:
  • synonym:
  • product: hypothetical protein

Genome View[edit source | edit]

Gene[edit source | edit]

General[edit source | edit]

  • type: CDS
  • locus tag: NWMN_2249 [new locus tag: NWMN_RS12950 ]
  • symbol: NWMN_2249
  • product: hypothetical protein
  • replicon: chromosome
  • strand: +
  • coordinates: 2471660..2472151
  • length: 492
  • essential: unknown other strains

Accession numbers[edit source | edit]

Phenotype[edit source | edit]

  • Share your knowledge and add information here. [edit]

DNA sequence[edit source | edit]

  • 1
    61
    121
    181
    241
    301
    361
    421
    481
    ATGGTTATTATCAAACAACTTTTTACACATACTCAAACCGTAACATCTGAATTCATTGAC
    CATAACAATCATATGCATGATGCAAATTATAATATCATTTTTAGTGACGTCGTGAATCGT
    TTTAATTACAGCCACGGTCTTTCTTTAAAAGAACGCGAAAATTTAGCATATACGCTATTT
    ACACTAGAAGAACATACGACATACCTCTCAGAATTGTCTCTTGGCGATGTATTTACTGTT
    ACTTTATATATTTATGATTACGATTATAAGCGGTTGCATTTATTTTTAACATTAACTAAA
    GAAGATGGTACACTAGCATCAACAAATGAAGTAATGATGATGGGAATTAATCAGCACACA
    CGTCGTTCTGATGCTTTTCCTGAATCATTTTCAACACAAATAGCACACTATTATAAAAAT
    CAATCAACTATCACTTGGCCTGAACAATTAGGACATAAAATAGCAATTCCACACAAAGGA
    GCATTAAAATGA
    60
    120
    180
    240
    300
    360
    420
    480
    492

Protein[edit source | edit]

General[edit source | edit]

  • locus tag: NWMN_2249 [new locus tag: NWMN_RS12950 ]
  • symbol: NWMN_2249
  • description: hypothetical protein
  • length: 163
  • theoretical pI: 6.58504
  • theoretical MW: 19024.3
  • GRAVY: -0.365644

Function[edit source | edit]

  • reaction:
  • TIGRFAM:
    Unknown functionGeneralacyl-CoA thioester hydrolase, YbgC/YbaW family (TIGR00051; HMM-score: 17.2)
    tol-pal system-associated acyl-CoA thioesterase (TIGR02799; EC 3.1.2.-; HMM-score: 13.7)
  • TheSEED:  
    Amino Acids and DerivativesBranched-chain amino acidsIsoleucine degradation 3-hydroxyacyl-CoA dehydrogenase (EC 1.1.1.35) 
    Branched-chain amino acidsValine degradation 3-hydroxyacyl-CoA dehydrogenase (EC 1.1.1.35) 
    CarbohydratesFermentationAcetyl-CoA fermentation to Butyrate 3-hydroxyacyl-CoA dehydrogenase (EC 1.1.1.35) 
    Fatty Acids, Lipids, and IsoprenoidsFatty Acids, Lipids, and Isoprenoids - no subcategoryPolyhydroxybutyrate metabolism 3-hydroxyacyl-CoA dehydrogenase (EC 1.1.1.35) 
    Butyrate metabolism cluster 3-hydroxyacyl-CoA dehydrogenase (EC 1.1.1.35) 
  • PFAM:
    HotDog (CL0050) 4HBT_2; Thioesterase-like superfamily (PF13279; HMM-score: 57.3)
    4HBT; Thioesterase superfamily (PF03061; HMM-score: 15.4)
    no clan definedTmpp129; Putative transmembrane protein precursor (PF10272; HMM-score: 9.2)

Structure, modifications & interactions[edit source | edit]

  • domains:
  • modifications:
  • cofactors:
  • effectors:
  • protein partners:

Localization[edit source | edit]

  • PSORTb: unknown (no significant prediction)
    • Cytoplasmic Score: 2.5
    • Cytoplasmic Membrane Score: 2.5
    • Cellwall Score: 2.5
    • Extracellular Score: 2.5
    • Internal Helices: 0
  • LocateP: Intracellular
    • Prediction by SwissProt Classification: Cytoplasmic
    • Pathway Prediction: No pathway
    • Intracellular Possibility: 1
    • Signal Peptide Possibility: -1
    • N-terminally Anchored Score: -1
    • Predicted Cleavage Site: No CleavageSite
  • SignalP: no predicted signal peptide
    • Ymax: 0.185
    • Ymax_pos: 20
    • Cmax: 0.132
    • Cmax_pos: 20
    • Smax: 0.347
    • Smax_pos: 9
    • Smean: 0.255
    • D: 0.212
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit source | edit]

Protein sequence[edit source | edit]

  • MVIIKQLFTHTQTVTSEFIDHNNHMHDANYNIIFSDVVNRFNYSHGLSLKERENLAYTLFTLEEHTTYLSELSLGDVFTVTLYIYDYDYKRLHLFLTLTKEDGTLASTNEVMMMGINQHTRRSDAFPESFSTQIAHYYKNQSTITWPEQLGHKIAIPHKGALK

Experimental data[edit source | edit]

  • experimentally validated: no data available

Expression & Regulation[edit source | edit]

Operon[edit source | edit]

Regulation[edit source | edit]

  • sigma factor:
  • regulator:

Transcription pattern[edit source | edit]

Protein synthesis (provided by Aureolib)[edit source | edit]

Protein stability[edit source | edit]

  • half-life: no data available

Biological Material[edit source | edit]

Mutants[edit source | edit]

Expression vector[edit source | edit]

lacZ fusion[edit source | edit]

GFP fusion[edit source | edit]

two-hybrid system[edit source | edit]

FLAG-tag construct[edit source | edit]

Antibody[edit source | edit]

Other Information[edit source | edit]

You are kindly invited to share additional interesting facts.

Literature[edit source | edit]

References[edit source | edit]

Relevant publications[edit source | edit]